Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Rabbit Anti-Human BMP 7 Polyclonal Antibody

Cat.No. : CPB-1276RH
Product Overview : IgGAnti Human BMP 7 is developed in rabbit using recombinant Human BMP 7 producedin plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : CPB-1276RH
Anigen Description : The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity.
Immunogen : STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Source : Rabbit.
Cross Reactivity : No cross reactions with other mammalian proteins.
Formulation : Provided as 0.2 μm sterile filtered solution in phosphate buffered saline. Lyophilized.
Applications : 1. Western Blot: to detect human INHBA by WB analysis this IgG can be used in a dilution of 1/500.2. Neutralization: No data available.Where this antibody has not been tested for use in a particular technique this not necessarily excludes its use in such procedures.Optimal dilution conditions should be determined by the final user.
Storage : Store at -20ºC. For long term storage freezes in working aliquots at -20ºC. Repeated freezing and thawing is not recommended.
Gene Name : BMP7 bone morphogenetic protein 7 [ Homo sapiens ]
Official Symbol : BMP 7
Synonyms : BMP 7; bone morphogenetic protein 7; OP-1; OTTHUMP00000031357; OTTHUMP00000166092; OTTHUMP00000166093; OTTHUMP00000166094; osteogenic protein 1;Eptotermin alfa.
Gene ID : 655
mRNA Refseq : NM_001719
Protein Refseq : NP_001710
MIM : 112267
UniProt ID : P18075
Chromosome Location : 20q13
Function : cytokine activity; growth factor activity; heparin binding; protein binding; contributes to protein binding.

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Are there any potential side effects or risks associated with BMP7 treatment? 01/31/2023

Yes, potential side effects include inflammation, swelling, and in rare cases, excessive bone growth.

How does BMP7 contribute to bone healing? 03/08/2022

BMP7 stimulates the differentiation of mesenchymal stem cells into osteoblasts, promoting bone formation and repair.

Can BMP7 be used in spinal fusion surgeries? 05/13/2021

Yes, BMP7 is often used in spinal fusion surgeries to stimulate bone growth and enhance the fusion process.

In what medical conditions is BMP7 protein commonly used? 02/08/2018

BMP7 is commonly used in conditions such as bone fractures, spinal fusions, and non-union fractures.

Is BMP7 exclusively used in orthopedic applications? 01/13/2017

While orthopedics is a primary application, BMP7 is also being explored for its potential in treating kidney and eye disorders.

Customer Reviews (3)

Write a review
Reviews
01/08/2022

    By incorporating the BMP7 protein into electron microscopy studies, researchers gain insights into the intricate three-dimensional architecture of proteins, facilitating a deeper comprehension of their functions and aiding in the development of novel therapeutics.

    04/26/2021

      Its reliability and effectiveness in generating accurate data make it an indispensable resource, driving scientific exploration and advancing our understanding of protein structure and function

      05/13/2017

        The BMP7 protein is an exceptional product that meets the highest standards of quality, making it an ideal choice to fulfill my experimental requirements.

        Ask a Question for All BMP7 Products

        Required fields are marked with *

        My Review for All BMP7 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends