Rabbit Anti-Human BMP 7 Polyclonal Antibody
- Specification
- Gene Information
- Related Products
Cat. No. : | CPB-1276RH |
Anigen Description : | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. |
Immunogen : | STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
Source : | Rabbit. |
Cross Reactivity : | No cross reactions with other mammalian proteins. |
Formulation : | Provided as 0.2 μm sterile filtered solution in phosphate buffered saline. Lyophilized. |
Applications : | 1. Western Blot: to detect human INHBA by WB analysis this IgG can be used in a dilution of 1/500.2. Neutralization: No data available.Where this antibody has not been tested for use in a particular technique this not necessarily excludes its use in such procedures.Optimal dilution conditions should be determined by the final user. |
Storage : | Store at -20ºC. For long term storage freezes in working aliquots at -20ºC. Repeated freezing and thawing is not recommended. |
Gene Name : | BMP7 bone morphogenetic protein 7 [ Homo sapiens ] |
Official Symbol : | BMP 7 |
Synonyms : | BMP 7; bone morphogenetic protein 7; OP-1; OTTHUMP00000031357; OTTHUMP00000166092; OTTHUMP00000166093; OTTHUMP00000166094; osteogenic protein 1;Eptotermin alfa. |
Gene ID : | 655 |
mRNA Refseq : | NM_001719 |
Protein Refseq : | NP_001710 |
MIM : | 112267 |
UniProt ID : | P18075 |
Chromosome Location : | 20q13 |
Function : | cytokine activity; growth factor activity; heparin binding; protein binding; contributes to protein binding. |
Products Types
◆ Recombinant Protein | ||
BMP7-282H | Active Recombinant Human BMP7 Protein (Met315-His431), C-His tagged, Animal-free, Carrier-free | +Inquiry |
BMP7-05H | Active Recombinant Human BMP7 Protein, Animal Free | +Inquiry |
BMP7-17H | Recombinant Active Human BMP7 Protein, His-tagged(C-ter) | +Inquiry |
BMP7-27031TH | Active Recombinant Human BMP7 protein | +Inquiry |
BMP7-016H | Recombinant Human BMP7 protein | +Inquiry |
◆ Lysates | ||
BMP7-8429HCL | Recombinant Human BMP7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionYes, potential side effects include inflammation, swelling, and in rare cases, excessive bone growth.
BMP7 stimulates the differentiation of mesenchymal stem cells into osteoblasts, promoting bone formation and repair.
Yes, BMP7 is often used in spinal fusion surgeries to stimulate bone growth and enhance the fusion process.
BMP7 is commonly used in conditions such as bone fractures, spinal fusions, and non-union fractures.
While orthopedics is a primary application, BMP7 is also being explored for its potential in treating kidney and eye disorders.
Customer Reviews (3)
Write a reviewBy incorporating the BMP7 protein into electron microscopy studies, researchers gain insights into the intricate three-dimensional architecture of proteins, facilitating a deeper comprehension of their functions and aiding in the development of novel therapeutics.
Its reliability and effectiveness in generating accurate data make it an indispensable resource, driving scientific exploration and advancing our understanding of protein structure and function
The BMP7 protein is an exceptional product that meets the highest standards of quality, making it an ideal choice to fulfill my experimental requirements.
Ask a Question for All BMP7 Products
Required fields are marked with *
My Review for All BMP7 Products
Required fields are marked with *
Inquiry Basket