Rabbit Anti-Human BMP 7 Polyclonal Antibody
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Rabbit |
Tag : | Non |
Anigen Description : | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. |
Immunogen : | STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
Cross Reactivity : | No cross reactions with other mammalian proteins. |
Formulation : | Provided as 0.2 μm sterile filtered solution in phosphate buffered saline. Lyophilized. |
Applications : | 1. Western Blot: to detect human INHBA by WB analysis this IgG can be used in a dilution of 1/500.2. Neutralization: No data available.Where this antibody has not been tested for use in a particular technique this not necessarily excludes its use in such procedures.Optimal dilution conditions should be determined by the final user. |
Storage : | Store at -20ºC. For long term storage freezes in working aliquots at -20ºC. Repeated freezing and thawing is not recommended. |
Gene Name | BMP7 bone morphogenetic protein 7 [ Homo sapiens ] |
Official Symbol | BMP 7 |
Synonyms | BMP 7; bone morphogenetic protein 7; OP-1; OTTHUMP00000031357; OTTHUMP00000166092; OTTHUMP00000166093; OTTHUMP00000166094; osteogenic protein 1;Eptotermin alfa. |
Gene ID | 655 |
mRNA Refseq | NM_001719 |
Protein Refseq | NP_001710 |
MIM | 112267 |
UniProt ID | P18075 |
Chromosome Location | 20q13 |
Function | cytokine activity; growth factor activity; heparin binding; protein binding; contributes to protein binding. |
◆ Recombinant Proteins | ||
BMP7-11H | Recombinant Human BMP7 protein, His-tagged | +Inquiry |
BMP7-26285TH | Recombinant Human BMP7, His-tagged | +Inquiry |
BMP7-163H | Active Recombinant Human BMP7 Protein, Biotinylated | +Inquiry |
BMP7-1548H | Recombinant human BMP7, Active | +Inquiry |
BMP7-274H | Recombinant Human BMP7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP7-8429HCL | Recombinant Human BMP7 293 Cell Lysate | +Inquiry |
CPB-1276RH | Rabbit Anti-Human BMP 7 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP7 Products
Required fields are marked with *
My Review for All BMP7 Products
Required fields are marked with *
0
Inquiry Basket