"PRG4" Related Products

Expand

Recombinant Human PRG4, GST-tagged

Cat. No.: PRG4-1501H
Product Overview: Recombinant Human PRG4 encoding (1305 a.a. - 1404 a.a.), fused a GST-tag at N-terminal, was expressed in Wheat germ.
Description: The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Molecular Mass: 36.74 kDa
Purity: Glutathione Sepharose 4 Fast Flow
Applications: WB
Sequence: ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNID VPSRTARAITTRSGQTLSKVWYNCP
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
OfficialSymbol: PRG4
Gene Name: PRG4 proteoglycan 4 [ Homo sapiens ]
Synonyms: PRG4; proteoglycan 4; MSF; SZP; CACP; HAPO; JCAP; FLJ32635; bG174L6.2; lubricin; OTTHUMP00000033580; megakaryocyte stimulating factor; articular superficial zone protein; bG174L6.2 (MSF: megakaryocyte stimulating factor ); proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome); Megakaryocyte-stimulating factor; Superficial zone proteoglycan; Proteoglycan 4 C-terminal part
Gene ID: 10216
mRNA Refseq: NM_005807
Protein Refseq: NP_005798
MIM: 604283
UniProt ID: Q92954
Chromosome Location: 1q25-q31
Function: polysaccharide binding; protein binding; scavenger receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.