Mouse Anti-PTRF Monoclonal Antibody

PRODUCTS

Home / Products / Antibody / Mouse Anti-PTRF Monoclonal Antibody

Mouse Anti-PTRF Monoclonal Antibody

PTRF Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DMABT-H14716
Product Overview : Mouse Anti-PTRF Monoclonal Antibody
Target : PTRF
Immunogen : PTRF (NP_036364, 233 a.a. ~432a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Host : Mouse
Isotype : IgG2b Kappa
species : Human
Clone : 2G8
Conjugation : N/A
Applications : WB,IHC,ICC,IP
Sequence similarities : KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVV YARSKTAVYKVPPF
Storage : Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Size : 100 μg
Gene Name : PTRF polymerase I and transcript release factor [ Homo sapiens ]
Official Symbol : PTRF
Synonyms : PTRF; polymerase I and transcript release factor; cavin 1; CAVIN1; TTF-I interacting peptide 12; RNA polymerase I and transcript release factor; CGL4; CAVIN; FKSG13; cavin-1; FLJ90031;
Gene ID : 284119
mRNA Refseq : NM_012232
Protein Refseq : NP_036364
MIM : 603198
UniProt ID : Q6NZI2
Chromosome Location : 17q21.31
Pathway : Gene Expression, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I Transcription Termination, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem;
Function : protein binding; rRNA primary transcript binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.