"PTRF" Related Products

Expand
Expand

Mouse Anti-PTRF Monoclonal Antibody

Cat.No.: DMABT-H14716
Product Overview: Mouse Anti-PTRF Monoclonal Antibody
Target: PTRF
Immunogen: PTRF (NP_036364, 233 a.a. ~432a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Host: Mouse
Isotype: IgG2b Kappa
species: Human
Clone: 2G8
Conjugation: N/A
Applications: WB,IHC,ICC,IP
Sequence similarities: KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVV YARSKTAVYKVPPF
Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Size: 100 μg
Gene Name: PTRF polymerase I and transcript release factor [ Homo sapiens ]
Official Symbol: PTRF
Synonyms: PTRF; polymerase I and transcript release factor; cavin 1; CAVIN1; TTF-I interacting peptide 12; RNA polymerase I and transcript release factor; CGL4; CAVIN; FKSG13; cavin-1; FLJ90031;
Gene ID: 284119
mRNA Refseq: NM_012232
Protein Refseq: NP_036364
MIM: 603198
UniProt ID: Q6NZI2
Chromosome Location: 17q21.31
Pathway: Gene Expression, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I Transcription Termination, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem;
Function: protein binding; rRNA primary transcript binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.