Active Recombinant Mouse IL7 Protein

Cat.No. : Il7-475M
Product Overview : Interleukin-7 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 129 amino acids and having a molecular mass of 14.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Molecular Weight : 14.9 kDa
AA Sequence : ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Bio-Activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is less than 0.2 ng/mL, corresponding to a specific activity of >5.0×10^6 IU/mg.
Purity : Greater than 96.0% as determined by: (a) Analysis by RP-HPLC; (b) Analysis by SDS-PAGE.
Notes : Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Solubility : It is recommended to reconstitute the lyophilized Interleukin 7 in sterile 18 MΩ-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions.
Stability : Lyophilized Interleukin-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution IL7 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Storage Buffer : Filtered (0.2μm) and lyophilized from a concentrated (1 mg/mL) solution in 1×PBS, pH7.4 and 2% trehalose.
Reference : 1. Disruption of Bis Leads to the Deterioration of the Vascular Niche for Hematopoietic Stem Cells. Publication: Stem Cells 28.2 (2010): 268-278.
Gene Name Il7 interleukin 7 [ Mus musculus ]
Official Symbol Il7
Synonyms IL7; interleukin 7; interleukin-7; Il-7; hlb368; A630026I06Rik; MGC129342
Gene ID 16196
mRNA Refseq NM_008371
Protein Refseq NP_032397
UniProt ID P10168

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il7 Products

Required fields are marked with *

My Review for All Il7 Products

Required fields are marked with *

0
cart-icon
0
compare icon