Recombinant Human Myosin, Light Chain 1, His-tagged

• Cat.No.: MYL1-4457H
• Product Overview: Recombinant human MYL1 protein with a His-tag was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.
• Molecular Mass: The protein has a calculated MW of 23.3 kDa.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from 10mM Tris -HCI, 1mM EDTA PH 7.5, 5% trehalose, 5% manitol

Gene Information

• Gene Name: MYL1 myosin, light chain 1, alkali; skeletal, fast [ Homo sapiens (human) ]
• Official Symbol: MYL1
• Synonyms: MYL1; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast; myosin light chain 1/3, skeletal muscle isoform; MLC1/MLC3; MLC1F/MLC3F; A1 catalytic; A2 catalytic; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin, light polypeptide 1, alkali; skeletal, fast; MLC1F; MLC3F
• Gene ID: 4632
• mRNA Refseq: NM_079420
• Protein Refseq: NP_524144
• MIM: 160780
• UniProt ID: P05976