Recombinant Tissue Factor Pathway Inhibitor 2, His-tagged

Cat.No. : TFPI2-4641H
Product Overview : TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Tag : His
Description : TFPI2 takes part in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 doesnμt have any influence on thrombin.
Form : Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1.
Purity : Greater than 97.0% as determined by SDS-PAGE.
Physical Appearance : Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility : It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions.
Amino acid sequence : HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
Storage : Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFPI2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens ]
Official Symbol TFPI2
Synonyms TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI-2; FLJ21164; PP5; REF1; TFPI-2; FLJ21164; Placental protein 5
Gene ID 7980
mRNA Refseq NM_006528
Protein Refseq NP_006519
MIM 600033
UniProt ID P48307
Chromosome Location 7q
Function extracellular matrix structural constituent; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFPI2 Products

Required fields are marked with *

My Review for All TFPI2 Products

Required fields are marked with *

0
cart-icon
0
compare icon