Recombinant Tissue Factor Pathway Inhibitor 2, His-tagged

• Cat.No.: TFPI2-4641H
• Product Overview: TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.

Specification

• Cat. No.: TFPI2-4641H
• Description: TFPI2 takes part in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 doesnμt have any influence on thrombin.
• Source: Human
• Host: Nicotiana benthamiana
• Form: Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1.
• Purity: Greater than 97.0% as determined by SDS-PAGE.
• Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Solubility: It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions.
• Amino acid sequence: HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
• Storage: Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFPI2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Gene Information

• Gene Name: TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens ]
• Official Symbol: TFPI2
• Synonyms: TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI-2; FLJ21164; PP5; REF1; TFPI-2; FLJ21164; Placental protein 5
• Gene ID: 7980
• mRNA Refseq: NM_006528
• Protein Refseq: NP_006519
• MIM: 600033
• UniProt ID: P48307
• Chromosome Location: 7q
• Function: extracellular matrix structural constituent; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity