Recombinant Tissue Factor Pathway Inhibitor 2, His-tagged
Cat.No. : | TFPI2-4641H |
Product Overview : | TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Tag : | His |
Description : | TFPI2 takes part in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 doesnμt have any influence on thrombin. |
Form : | Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1. |
Purity : | Greater than 97.0% as determined by SDS-PAGE. |
Physical Appearance : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Solubility : | It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions. |
Amino acid sequence : | HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV. |
Storage : | Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFPI2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens ] |
Official Symbol | TFPI2 |
Synonyms | TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI-2; FLJ21164; PP5; REF1; TFPI-2; FLJ21164; Placental protein 5 |
Gene ID | 7980 |
mRNA Refseq | NM_006528 |
Protein Refseq | NP_006519 |
MIM | 600033 |
UniProt ID | P48307 |
Chromosome Location | 7q |
Function | extracellular matrix structural constituent; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity |
◆ Recombinant Proteins | ||
TFPI2-129H | Active Recombinant Human TFPI2, Animal Free | +Inquiry |
TFPI2-226H | Recombinant Human TFPI2 Protein, His-tagged | +Inquiry |
Tfpi2-7415M | Recombinant Mouse Tfpi2 protein(Met1-Lys211), hFc-tagged | +Inquiry |
Tfpi2-1997R | Recombinant Rat Tfpi2 protein, His-tagged | +Inquiry |
TFPI2-6598H | Recombinant Human TFPI2 Protein (Asp23-Ile230), N-His tagged | +Inquiry |
◆ Native Proteins | ||
TFPI2C-65H | Recombinant Human TFPI2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFPI2-1519MCL | Recombinant Mouse TFPI2 cell lysate | +Inquiry |
TFPI2-2771HCL | Recombinant Human TFPI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFPI2 Products
Required fields are marked with *
My Review for All TFPI2 Products
Required fields are marked with *