"TFPI2" Related Products

Expand
Expand

Recombinant Tissue Factor Pathway Inhibitor 2, His-tagged

Cat. No.: TFPI2-4641H
Product Overview: TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
Description: TFPI2 takes part in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 doesnμt have any influence on thrombin.
Source: Human
Host: Nicotiana benthamiana
Form: Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1.
Purity: Greater than 97.0% as determined by SDS-PAGE.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility: It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions.
Amino acid sequence: HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
Storage: Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFPI2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name: TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens ]
Official Symbol: TFPI2
Synonyms: TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI-2; FLJ21164; PP5; REF1; TFPI-2; FLJ21164; Placental protein 5
Gene ID: 7980
mRNA Refseq: NM_006528
Protein Refseq: NP_006519
MIM: 600033
UniProt ID: P48307
Chromosome Location: 7q
Function: extracellular matrix structural constituent; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.