Recombinant Drosophila Melanogaster Trithorax-Like
Cat.No. : | Trl-4370D |
Product Overview : | GAGA-POZ Drosophila Melanogaster Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids & having a molecular mass of 14 kDa. |
- Specification
- Gene Information
- Related Products
Cat. No. : | Trl-4370D |
Description : | The GAGA factor is a sequence-specific DNA-binding protein, which participates in the regulation of the expression of a variety of different classes of genes in Drosophila such as many developmentally regulated genes, stress induced genes, and cell cycle regulated genes, as well as housekeeping genes. GAGA contains a C-terminal glutamine-rich domain and a highly conserved N-terminal POZ domain which reported to be involved in self-oligomerization in a number of other POZ domain containing proteins. In case of GAGA protein, the N-terminal POZ domain mediates the formation of oligomers both in vitro and in vivo. |
Source : | Drosophila Melanogaster |
Host : | Escherichia Coli |
Form : | The protein containing 10mM HEPES (pH-7.4) and 25mM NaCl. |
Purity : | Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE; Sterile filtered colorless solution. |
Physical Appearance : | Sterile filtered colorless solution. |
Amino Acid Sequence : | MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGR SFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALL EFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH |
Storage : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |
Functions : | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding |
Gene Name : | Trl Trithorax-like [ Drosophila melanogaster ] |
Official Symbol : | Trl |
Synonyms : | trl; Adf-2; Adf-2-519; Adf2; anon-EST:fe2E12; CG- 33261; CG9343; Dmel\CG33261; E(var)3-trl; E(var)62; Gaf; GAF; gaga; Gaga; GAGA; l(3)s2325; Nc70F; NC70F; TfGA- GA/Adf-2; TRL; Trl-GAGA |
Gene ID : | 2768981 |
mRNA Refseq : | NM_001038926 |
Protein Refseq : | NP_001034015 |
MIM : | 605125 |
UniProt ID : | Q2PDY2 |
Chromosome Location : | 70F4-70F4 |
Products Types
◆ Recombinant Protein | ||
Trl-352D | Recombinant Drosophila Melanogaster Trithorax-like, Isoform A | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All Trl Products
Required fields are marked with *
My Review for All Trl Products
Required fields are marked with *
0
Inquiry Basket