Recombinant Drosophila Melanogaster Trithorax-Like Trl-4370D

Recombinant Drosophila Melanogaster Trithorax-Like

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Drosophila Melanogaster Trithorax-Like

Recombinant Drosophila Melanogaster Trithorax-Like

Trl Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : Trl-4370D
Product Overview : GAGA-POZ Drosophila Melanogaster Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids & having a molecular mass of 14 kDa.
Description : The GAGA factor is a sequence-specific DNA-binding protein, which participates in the regulation of the expression of a variety of different classes of genes in Drosophila such as many developmentally regulated genes, stress induced genes, and cell cycle regulated genes, as well as housekeeping genes. GAGA contains a C-terminal glutamine-rich domain and a highly conserved N-terminal POZ domain which reported to be involved in self-oligomerization in a number of other POZ domain containing proteins. In case of GAGA protein, the N-terminal POZ domain mediates the formation of oligomers both in vitro and in vivo.
Source : Drosophila Melanogaster
Host : Escherichia Coli
Form : The protein containing 10mM HEPES (pH-7.4) and 25mM NaCl.
Purity : Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE; Sterile filtered colorless solution.
Physical Appearance : Sterile filtered colorless solution.
Amino Acid Sequence : MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGR SFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALL EFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Functions : DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding
Gene Name : Trl Trithorax-like [ Drosophila melanogaster ]
Official Symbol : Trl
Synonyms : trl; Adf-2; Adf-2-519; Adf2; anon-EST:fe2E12; CG- 33261; CG9343; Dmel\CG33261; E(var)3-trl; E(var)62; Gaf; GAF; gaga; Gaga; GAGA; l(3)s2325; Nc70F; NC70F; TfGA- GA/Adf-2; TRL; Trl-GAGA
Gene ID : 2768981
mRNA Refseq : NM_001038926
Protein Refseq : NP_001034015
MIM : 605125
UniProt ID : Q2PDY2
Chromosome Location : 70F4-70F4

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy