Recombinant Drosophila Melanogaster Trithorax-Like

Cat.No. : Trl-4370D
Product Overview : GAGA-POZ Drosophila Melanogaster Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids & having a molecular mass of 14 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Drosophila
Source : Drosophila Melanogaster
Tag : Non
Description : The GAGA factor is a sequence-specific DNA-binding protein, which participates in the regulation of the expression of a variety of different classes of genes in Drosophila such as many developmentally regulated genes, stress induced genes, and cell cycle regulated genes, as well as housekeeping genes. GAGA contains a C-terminal glutamine-rich domain and a highly conserved N-terminal POZ domain which reported to be involved in self-oligomerization in a number of other POZ domain containing proteins. In case of GAGA protein, the N-terminal POZ domain mediates the formation of oligomers both in vitro and in vivo.
Form : The protein containing 10mM HEPES (pH-7.4) and 25mM NaCl.
Purity : Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE; Sterile filtered colorless solution.
Physical Appearance : Sterile filtered colorless solution.
Amino Acid Sequence : MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGR SFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALL EFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Functions : DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding
Gene Name Trl Trithorax-like [ Drosophila melanogaster ]
Official Symbol Trl
Synonyms trl; Adf-2; Adf-2-519; Adf2; anon-EST:fe2E12; CG- 33261; CG9343; Dmel\CG33261; E(var)3-trl; E(var)62; Gaf; GAF; gaga; Gaga; GAGA; l(3)s2325; Nc70F; NC70F; TfGA- GA/Adf-2; TRL; Trl-GAGA
Gene ID 2768981
mRNA Refseq NM_001038926
Protein Refseq NP_001034015
MIM 605125
UniProt ID Q2PDY2
Chromosome Location 70F4-70F4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Trl Products

Required fields are marked with *

My Review for All Trl Products

Required fields are marked with *

0

Inquiry Basket

cartIcon