Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Drosophila Melanogaster Trithorax-Like

Cat.No. : Trl-4370D
Product Overview : GAGA-POZ Drosophila Melanogaster Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids & having a molecular mass of 14 kDa.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : Trl-4370D
Description : The GAGA factor is a sequence-specific DNA-binding protein, which participates in the regulation of the expression of a variety of different classes of genes in Drosophila such as many developmentally regulated genes, stress induced genes, and cell cycle regulated genes, as well as housekeeping genes. GAGA contains a C-terminal glutamine-rich domain and a highly conserved N-terminal POZ domain which reported to be involved in self-oligomerization in a number of other POZ domain containing proteins. In case of GAGA protein, the N-terminal POZ domain mediates the formation of oligomers both in vitro and in vivo.
Source : Drosophila Melanogaster
Host : Escherichia Coli
Form : The protein containing 10mM HEPES (pH-7.4) and 25mM NaCl.
Purity : Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE; Sterile filtered colorless solution.
Physical Appearance : Sterile filtered colorless solution.
Amino Acid Sequence : MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGR SFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALL EFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Functions : DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding
Gene Name : Trl Trithorax-like [ Drosophila melanogaster ]
Official Symbol : Trl
Synonyms : trl; Adf-2; Adf-2-519; Adf2; anon-EST:fe2E12; CG- 33261; CG9343; Dmel\CG33261; E(var)3-trl; E(var)62; Gaf; GAF; gaga; Gaga; GAGA; l(3)s2325; Nc70F; NC70F; TfGA- GA/Adf-2; TRL; Trl-GAGA
Gene ID : 2768981
mRNA Refseq : NM_001038926
Protein Refseq : NP_001034015
MIM : 605125
UniProt ID : Q2PDY2
Chromosome Location : 70F4-70F4

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends