Cat. No. : |
Trl-4370D |
Description : |
The GAGA factor is a sequence-specific DNA-binding protein, which participates in the regulation of the expression of a variety of different classes of genes in Drosophila such as many developmentally regulated genes, stress induced genes, and cell cycle regulated genes, as well as housekeeping genes. GAGA contains a C-terminal glutamine-rich domain and a highly conserved N-terminal POZ domain which reported to be involved in self-oligomerization in a number of other POZ domain containing proteins. In case of GAGA protein, the N-terminal POZ domain mediates the formation of oligomers both in vitro and in vivo. |
Source : |
Drosophila Melanogaster |
Host : |
Escherichia Coli |
Form : |
The protein containing 10mM HEPES (pH-7.4) and 25mM NaCl. |
Purity : |
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE; Sterile filtered colorless solution. |
Physical Appearance : |
Sterile filtered colorless solution. |
Amino Acid Sequence : |
MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGR SFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALL EFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH |
Storage : |
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |
Functions : |
DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding |