Recombinant Drosophila Melanogaster Trithorax-Like
Cat.No. : | Trl-4370D |
Product Overview : | GAGA-POZ Drosophila Melanogaster Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids & having a molecular mass of 14 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila |
Source : | Drosophila Melanogaster |
Tag : | Non |
Description : | The GAGA factor is a sequence-specific DNA-binding protein, which participates in the regulation of the expression of a variety of different classes of genes in Drosophila such as many developmentally regulated genes, stress induced genes, and cell cycle regulated genes, as well as housekeeping genes. GAGA contains a C-terminal glutamine-rich domain and a highly conserved N-terminal POZ domain which reported to be involved in self-oligomerization in a number of other POZ domain containing proteins. In case of GAGA protein, the N-terminal POZ domain mediates the formation of oligomers both in vitro and in vivo. |
Form : | The protein containing 10mM HEPES (pH-7.4) and 25mM NaCl. |
Purity : | Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE; Sterile filtered colorless solution. |
Physical Appearance : | Sterile filtered colorless solution. |
Amino Acid Sequence : | MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGR SFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALL EFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH |
Storage : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |
Functions : | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding |
Gene Name | Trl Trithorax-like [ Drosophila melanogaster ] |
Official Symbol | Trl |
Synonyms | trl; Adf-2; Adf-2-519; Adf2; anon-EST:fe2E12; CG- 33261; CG9343; Dmel\CG33261; E(var)3-trl; E(var)62; Gaf; GAF; gaga; Gaga; GAGA; l(3)s2325; Nc70F; NC70F; TfGA- GA/Adf-2; TRL; Trl-GAGA |
Gene ID | 2768981 |
mRNA Refseq | NM_001038926 |
Protein Refseq | NP_001034015 |
MIM | 605125 |
UniProt ID | Q2PDY2 |
Chromosome Location | 70F4-70F4 |
◆ Recombinant Proteins | ||
Trl-4370D | Recombinant Drosophila Melanogaster Trithorax-Like | +Inquiry |
Trl-352D | Recombinant Drosophila Melanogaster Trithorax-like, Isoform A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Trl Products
Required fields are marked with *
My Review for All Trl Products
Required fields are marked with *
0
Inquiry Basket