Recombinant Human CSF3 protein

Cat.No. : CSF3-223H
Product Overview : Recombinant Human CSF3 protein was expressed in Escherichia coli.
Availability December 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 174
Description : Granulocyte colony stimulating factor (G-CSF) is a pleiotropic cytokine. It is mainly produced by monocytes and macrophages upon activation by endotoxin, TNF-α and IFN-γ. Besides, many other cell types can secreted this protein after LPS, IL-1 or TNF-α activation, which are fibroblasts, endothelial cells, astrocytes and bone marrow stromal cells. Various carcinoma cell lines and myeloblastic leukemia cells can express G-CSF constitutively. G-CSF is cytokine that acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition it may function in some adhesion or recognition events at the cell surface. In humans, two distinct cDNA clones for G-CSF, encoding 207 and 204 amino acid (a.a.) precursor proteins, have been isolated. Both proteins have a 30 a.a. signal peptide and have identical amino acid sequences except for a three a.a. insertion (deletion) at the 35th a.a. residue from the N-terminus of the mature protein. Human G-CSF is 73 % identical at the amino acid level to murine G-CSF and the two proteins show species cross-reactivity.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 10mM sodium acetate buffer, containing 5 % trehalose, pH 4.0.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
AA Sequence : TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Endotoxin : Less than 1 EU/μg of rHuG-CSF as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CSF3
Official Symbol CSF3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33;
Gene ID 1440
mRNA Refseq NM_000759
Protein Refseq NP_000750
MIM 138970
UniProt ID P09919

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF3 Products

Required fields are marked with *

My Review for All CSF3 Products

Required fields are marked with *

0
cart-icon
0
compare icon