"CSF3" Related Products

Recombinant Human CSF3 Protein

Cat.No.: CSF3-223H
Product Overview: Recombinant human G-CSF is an 18.7 kDa protein consisting of 174 amino acid residues without tag was expressed in E.coli.
Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene.
Source: E. coli
Species: Human
Bio-activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.
Molecular Mass: 18.7 kDa
AA Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity: Above 98% as determined by SDS-PAGE Analysis.
Gene Name: CSF3
Official Symbol: CSF3 colony stimulating factor 3 [ Homo sapiens (human) ]
Synonyms: CSF3; colony stimulating factor 3; GCSF; CSF3OS; C17orf33; granulocyte colony-stimulating factor; colony stimulating factor 3 (granulocyte); filgrastim; granulocyte-colony stimulating factor; lenograstim; pluripoietin
Gene ID: 1440
mRNA Refseq: NM_000759
Protein Refseq: NP_000750
MIM: 138970
UniProt ID: P09919

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.