Recombinant Human CSF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CSF3-4577H
• Product Overview: CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_000750) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene.
• Molecular Mass: 22.29 kDa
• AA Sequence: MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CSF3 colony stimulating factor 3 [ Homo sapiens (human) ]
• Official Symbol: CSF3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33, G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33
• Gene ID: 1440
• mRNA Refseq: NM_000759
• Protein Refseq: NP_000750
• MIM: 138970
• UniProt ID: P09919