"CSH1" Related Products

Expand
Expand

Recombinant Human Chorionic Somatomammotropin Hormone 1 (placental lactogen)

Cat. No. : CSH1-346H
Product Overview : Recombinant human CSH1 expressed by E. coli is a 22.3 kDa homodimeric protein.
Description : CSH1 is a polypeptide placental hormone. Its structure and function is similar to that of growth hormone. It modifies the metabolic state of the mother during pregnancy to facilitate the energy supply of the fetus. Recombinant human placental lactogen is a 22.3 kDa protein protein sequence.
Biological Activity : Test in process
Molecular Weight : 22.3 kDa
Source : E. coli
Species : Human
Form : Sterile filtered and lyophilized with no additives.
Endotoxin Level : <0.1 ng/μg
Appearance : Lyophilized protein
Sequence : MVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPT PSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEG IQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRTV QCRSVEGSCGF
Purity : >95% by SDS-PAGE and >95% by HPLC
Reconstitution : Reconstitute in water to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers.
Storage : The lyophilized Placental Lactogen is best-stored desiccated below 0°C. Reconstituted protein should be stored at working aliquots at -20°C. For long-term storage, it is recommended to add carrier protein (0.1% BSA).
Gene Name : CSH1 chorionic somatomammotropin hormone 1 (placental lactogen) [ Homo sapiens ]
Official Symbol : CSH1
Synonyms : CSH1; chorionic somatomammotropin hormone 1 (placental lactogen); PL; CSA; CS-1; CSMT; hCS-A; FLJ75407; chorionic somatomammotropin hormone; Choriomammotropin; placental lactogen; chorionic somatomammotropin A
Gene ID : 1442
mRNA Refseq : NM_001317
Protein Refseq : NP_001308
MIM : 150200
UniProt ID : P01243
Chromosome Location : 17q22-q24
Pathway : Jak-STAT signaling pathway; Neuroactive ligand-receptor interaction
Function : hormone activity; metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.