Recombinant Human Chorionic Somatomammotropin Hormone 1 (placental lactogen)
Cat.No. : | CSH1-346H |
Product Overview : | Recombinant human CSH1 expressed by E. coli is a 22.3 kDa homodimeric protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | CSH1 is a polypeptide placental hormone. Its structure and function is similar to that of growth hormone. It modifies the metabolic state of the mother during pregnancy to facilitate the energy supply of the fetus. Recombinant human placental lactogen is a 22.3 kDa protein protein sequence. |
Biological Activity : | Test in process |
Molecular Weight : | 22.3 kDa |
Form : | Sterile filtered and lyophilized with no additives. |
Endotoxin Level : | <0.1 ng/μg |
Appearance : | Lyophilized protein |
Sequence : | MVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPT PSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEG IQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRTV QCRSVEGSCGF |
Purity : | >95% by SDS-PAGE and >95% by HPLC |
Reconstitution : | Reconstitute in water to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers. |
Storage : | The lyophilized Placental Lactogen is best-stored desiccated below 0°C. Reconstituted protein should be stored at working aliquots at -20°C. For long-term storage, it is recommended to add carrier protein (0.1% BSA). |
Gene Name | CSH1 chorionic somatomammotropin hormone 1 (placental lactogen) [ Homo sapiens ] |
Official Symbol | CSH1 |
Synonyms | CSH1; chorionic somatomammotropin hormone 1 (placental lactogen); PL; CSA; CS-1; CSMT; hCS-A; FLJ75407; chorionic somatomammotropin hormone; Choriomammotropin; placental lactogen; chorionic somatomammotropin A |
Gene ID | 1442 |
mRNA Refseq | NM_001317 |
Protein Refseq | NP_001308 |
MIM | 150200 |
UniProt ID | P01243 |
Chromosome Location | 17q22-q24 |
Pathway | Jak-STAT signaling pathway; Neuroactive ligand-receptor interaction |
Function | hormone activity; metal ion binding |
◆ Native Proteins | ||
CSH1-31024TH | Native Human CSH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSH1-2206HCL | Recombinant Human CSH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSH1 Products
Required fields are marked with *
My Review for All CSH1 Products
Required fields are marked with *