| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
160 |
| Description : |
Interleukin-10 (IL-10) is encoded by the IL10 gene and expressed in monocytes and Type 2 T helper cells (Th2). The biological activities of IL-10 are mediated by the IL-10 receptor complex, which is composed of the ligand-binding IL-10 Rα/R1 and the accessory IL-10 Rβ/R2 subunits. IL-10 is capable of inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by T helper cells. IL-10 is classified as a class 2 cytokine which consist of IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26, several interferons and interferon-like molecules. Mature murine IL-10 shares 70 %-77 % amino acid sequence identity with human, bovine, porcine IL-10, but murine IL-10 does not act on human cells. |
| Form : |
Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
| Molecular Mass : |
Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. |
| AA Sequence : |
SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
| Endotoxin : |
Less than 1 EU/µg of rMuIL-10 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |