Recombinant Mouse Il10 protein, His-tagged
Cat.No. : | Il10-6143M |
Product Overview : | Recombinant Mouse Il10 protein(19-178 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | His |
Protein Length : | 19-178 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Gene Name | Il10 interleukin 10 [ Mus musculus ] |
Official Symbol | Il10 |
Synonyms | IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10; |
Gene ID | 16153 |
mRNA Refseq | NM_010548 |
Protein Refseq | NP_034678 |
◆ Recombinant Proteins | ||
Il10-501M | Recombinant Mouse Il10 protein, His-tagged | +Inquiry |
IL10-2049R | Recombinant Rhesus Macaque IL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL10-836C | Recombinant Cattle IL10 protein, His & T7-tagged | +Inquiry |
IL10-566H | Active Recombinant Human IL10, HIgG1 Fc-tagged | +Inquiry |
IL10-28293TH | Recombinant Human IL10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *