"SAK" Related Products

    Recombinant Staphylokinase (SAK) protein

    Cat.No. : SAK-05S
    Product Overview : Recombinant Staphylokinase (SAK) protein was expressed in Escherichia coli.
    Description : Staphylokinase is an amino acid enzyme secreted by several species of streptococci. It is a 16kDa potent plasminogen activator that converts plasminogen into plasmin which can digest fibrin the major constituent of blood thrombi. SAK forms 1:1 complex with plasmin, which is a positive feedback of producing other complexes. Recent studies on the thrombolytic potential of recombinant SAK in achieving early perfusion in myocardial infarction and in the dissolution of platelet-rich clot have clearly established its immense utility in clinical medicine as a thrombolytic agent and suggested that it can be developed as a potent clot-dissolving agent.
    Source : E.coli
    Species : Staphylococcus phage phiN315
    Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
    Bio-activity : Fully biologically active when compared to standard. The specific activity determined by fibrining lysis in agarose plate is 5.0 × 104 IU/mg.
    Molecular Mass : Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 136 amino acids.
    Protein length : 136
    AA Sequence : SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
    Endotoxin : Less than 1 EU/µg of rSAK as determined by LAL method.
    Purity : >97% by SDS-PAGE and HPLC analysis.
    Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
    Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
    Gene Name : SAK
    Official Symbol : SAK
    Synonyms : Sak42D
    Gene ID : 1260563
    Protein Refseq : NP_835575.1
    Products Types

    Related Gene
    SAK

    Online Inquiry

    Note: There will be extra charge for optional service!

    Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

    Optional requirements on this protein    +Expand

    Price Inquiry

    Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.