| Species : |
Staphylococcus phage phiN315 |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
136 |
| Description : |
Staphylokinase is an amino acid enzyme secreted by several species of streptococci. It is a 16kDa potent plasminogen activator that converts plasminogen into plasmin which can digest fibrin the major constituent of blood thrombi. SAK forms 1:1 complex with plasmin, which is a positive feedback of producing other complexes. Recent studies on the thrombolytic potential of recombinant SAK in achieving early perfusion in myocardial infarction and in the dissolution of platelet-rich clot have clearly established its immense utility in clinical medicine as a thrombolytic agent and suggested that it can be developed as a potent clot-dissolving agent. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The specific activity determined by fibrining lysis in agarose plate is 5.0 × 10⁴ IU/mg. |
| Molecular Mass : |
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 136 amino acids. |
| AA Sequence : |
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK |
| Endotoxin : |
Less than 1 EU/µg of rSAK as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
