Active Recombinant Streptokinase (SK) protein

Cat.No. : Streptokinase-06
Product Overview : Recombinant Streptokinase (SK) protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Streptococcus sp.
Source : E.coli
Tag : Non
Protein Length : 414
Description : Streptokinase is a thrombolytic agent i.e. it dissolves vascular thrombi. This potent agent is derived from the beta haemolytic streptococci and is consequently associated with the risk of anaphylaxis. Streptokinase acts by stimulating the conversion of plasminogen to plasmin. It is a proteolytic enzyme which is able to disrupt fibrin stability and production.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The specific activity determined by fibrining lysis in agarose plate is 8.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 47.3 kDa, a single non-glycosylated polypeptide chain containing 414 amino acids.
AA Sequence : IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK
Endotoxin : Less than 1 EU/μg of rSK as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
UniProt ID P10519

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Streptokinase Products

Required fields are marked with *

My Review for All Streptokinase Products

Required fields are marked with *

0

Inquiry Basket

cartIcon