Recombinant Human ADAMTS4, GST-tagged
| Cat.No. : | ADAMTS4-536H |
| Product Overview : | Recombinant Human ADAMTS4 (693 a.a. - 802 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma. |
| Molecular Mass : | 37.84 kDa |
| Sequence : | RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFV |
| Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note : | Best use within three months from the date of receipt of this protein. |
| OfficialSymbol : | ADAMTS4 |
| Gene Name | ADAMTS4 ADAM metallopeptidase with thrombospondin type 1 motif, 4 [ Homo sapiens ] |
| Synonyms | ADAM metallopeptidase with thrombospondin type 1 motif, 4; ADMP-1; ADAMTS-2; ADAMTS-4; KIAA0688; ADAMTS4; A disintegrin and metalloproteinase with thrombospondin motifs 4; ADAM-TS4; ADAM-TS 4; aggrecanase-1; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4; EC 3.4.24.82 |
| Gene ID | 9507 |
| mRNA Refseq | NM_005099 |
| Protein Refseq | NP_005090 |
| MIM | 603876 |
| UniProt ID | O75173 |
| Chromosome Location | 1q21-q23 |
| Pathway | Endochondral Ossification |
| Function | metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; protease binding; protein binding; zinc ion binding |
| ◆ Recombinant Proteins | ||
| ADAMTS4-1028H | Active Recombinant Human ADAMTS4 Protein, His-tagged | +Inquiry |
| Adamts4-1530M | Recombinant Mouse Adamts4 Protein, Myc/DDK-tagged | +Inquiry |
| ADAMTS4-1431H | Recombinant Human ADAMTS4 protein, GST-tagged | +Inquiry |
| ADAMTS4-506R | Recombinant Rat ADAMTS4 Protein | +Inquiry |
| ADAMTS4-535H | Recombinant Human ADAMTS4, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAMTS4-9029HCL | Recombinant Human ADAMTS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS4 Products
Required fields are marked with *
My Review for All ADAMTS4 Products
Required fields are marked with *
