Recombinant Human ADAMTS4, GST-tagged

Cat.No. : ADAMTS4-536H
Product Overview : Recombinant Human ADAMTS4 (693 a.a. - 802 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
Molecular Mass : 37.84 kDa
Sequence : RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFV
Storagebuffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note : Best use within three months from the date of receipt of this protein.
OfficialSymbol : ADAMTS4
Gene Name ADAMTS4 ADAM metallopeptidase with thrombospondin type 1 motif, 4 [ Homo sapiens ]
Synonyms ADAM metallopeptidase with thrombospondin type 1 motif, 4; ADMP-1; ADAMTS-2; ADAMTS-4; KIAA0688; ADAMTS4; A disintegrin and metalloproteinase with thrombospondin motifs 4; ADAM-TS4; ADAM-TS 4; aggrecanase-1; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4; EC 3.4.24.82
Gene ID 9507
mRNA Refseq NM_005099
Protein Refseq NP_005090
MIM 603876
UniProt ID O75173
Chromosome Location 1q21-q23
Pathway Endochondral Ossification
Function metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; protease binding; protein binding; zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS4 Products

Required fields are marked with *

My Review for All ADAMTS4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon