"hupA" Related Products

Recombinant E.coli hupA, His-tagged

Cat. No.: hupA-28E
Product Overview: Recombinant Escherichia coli O157:H7 hupA was expressed.
Description: Escherichia coli O157:H7 is an enterohemorrhagic strain of the bacterium Escherichia coli and a cause of illness through food. Infection may lead to hemorrhagic diarrhea, and to kidney failure.
Species: E. coli
Purity: >90%
AA sequence: MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK
ExpressionRegion: 1-90
Storage Buffer: PBS pH 7.4, 50% glycerol
Applications: Immunogen; ELISA
Storage: Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
OfficialSymbol: hupA
Gene Name: hupA transcriptional regulator HU subunit alpha [ Escherichia coli O157:H7 str. EDL933 ]
Synonyms: hupA; transcriptional regulator HU subunit alpha; histone-like DNA-binding protein
Gene ID: 960129
Protein Refseq: NP_290632
Chromosome Location: Escherichia coli C600

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.