Recombinant E.coli hupA, His-tagged hupA-28E

Recombinant E.coli hupA, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant E.coli hupA, His-tagged

Recombinant E.coli hupA, His-tagged

hupA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : hupA-28E
Product Overview : Recombinant Escherichia coli O157:H7 hupA was expressed.
Description : Escherichia coli O157:H7 is an enterohemorrhagic strain of the bacterium Escherichia coli and a cause of illness through food. Infection may lead to hemorrhagic diarrhea, and to kidney failure.
Species : E. coli
Purity : >90%
AA sequence : MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK
ExpressionRegion : 1-90
Storage Buffer : PBS pH 7.4, 50% glycerol
Applications : Immunogen; ELISA
Storage : Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
OfficialSymbol : hupA
Gene Name : hupA transcriptional regulator HU subunit alpha [ Escherichia coli O157:H7 str. EDL933 ]
Synonyms : hupA; transcriptional regulator HU subunit alpha; histone-like DNA-binding protein
Gene ID : 960129
Protein Refseq : NP_290632
Chromosome Location : Escherichia coli C600

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy