Recombinant E.coli hupA, His-tagged

Cat.No. : hupA-28E
Product Overview : Recombinant Escherichia coli O157:H7 hupA was expressed.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Tag : His
Description : Escherichia coli O157:H7 is an enterohemorrhagic strain of the bacterium Escherichia coli and a cause of illness through food. Infection may lead to hemorrhagic diarrhea, and to kidney failure.
Purity : >90%
AA sequence : MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK
ExpressionRegion : 1-90
Storage Buffer : PBS pH 7.4, 50% glycerol
Applications : Immunogen; ELISA
Storage : Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
OfficialSymbol : hupA
Gene Name hupA transcriptional regulator HU subunit alpha [ Escherichia coli O157:H7 str. EDL933 ]
Synonyms hupA; transcriptional regulator HU subunit alpha; histone-like DNA-binding protein
Gene ID 960129
Protein Refseq NP_290632
Chromosome Location Escherichia coli C600

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All hupA Products

Required fields are marked with *

My Review for All hupA Products

Required fields are marked with *

0
cart-icon