Recombinant E.coli hupA, His-tagged

• Cat.No.: hupA-28E
• Product Overview: Recombinant Escherichia coli O157:H7 hupA was expressed.

Specification

• Species: E.coli
• Tag: His
• Description: Escherichia coli O157:H7 is an enterohemorrhagic strain of the bacterium Escherichia coli and a cause of illness through food. Infection may lead to hemorrhagic diarrhea, and to kidney failure.
• Purity: >90%
• AA sequence: MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK
• ExpressionRegion: 1-90
• Storage Buffer: PBS pH 7.4, 50% glycerol
• Applications: Immunogen; ELISA
• Storage: Store at -20°C, for extended storage, conserve at -20°C or -80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• OfficialSymbol: hupA

Gene Information

• Gene Name: hupA transcriptional regulator HU subunit alpha [ Escherichia coli O157:H7 str. EDL933 ]
• Synonyms: hupA; transcriptional regulator HU subunit alpha; histone-like DNA-binding protein
• Gene ID: 960129
• Protein Refseq: NP_290632
• Chromosome Location: Escherichia coli C600