Recombinant E.coli hupA, His-tagged
Cat.No. : | hupA-28E |
Product Overview : | Recombinant Escherichia coli O157:H7 hupA was expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Tag : | His |
Description : | Escherichia coli O157:H7 is an enterohemorrhagic strain of the bacterium Escherichia coli and a cause of illness through food. Infection may lead to hemorrhagic diarrhea, and to kidney failure. |
Purity : | >90% |
AA sequence : | MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK |
ExpressionRegion : | 1-90 |
Storage Buffer : | PBS pH 7.4, 50% glycerol |
Applications : | Immunogen; ELISA |
Storage : | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
OfficialSymbol : | hupA |
Gene Name | hupA transcriptional regulator HU subunit alpha [ Escherichia coli O157:H7 str. EDL933 ] |
Synonyms | hupA; transcriptional regulator HU subunit alpha; histone-like DNA-binding protein |
Gene ID | 960129 |
Protein Refseq | NP_290632 |
Chromosome Location | Escherichia coli C600 |
◆ Recombinant Proteins | ||
hupA-4167E | Recombinant Escherichia coli O157:H7 hupA protein, His-SUMO-tagged | +Inquiry |
hupA-28E | Recombinant E.coli hupA, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All hupA Products
Required fields are marked with *
My Review for All hupA Products
Required fields are marked with *