"DEPDC1" Related Products

Recombinant Human DEPDC1, GST-tagged

Cat. No.: DEPDC1-120H
Product Overview: Recombinant Human DEPDC1 (93 a.a. - 186 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: DEP domain containing 1 is a protein that in humans is encoded by the DEPDC1 gene.
Source: wheat germ
Molecular Mass: 36.08 kDa
Sequence: GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
Purification: Glutathione Sepharose 4 Fast Flow
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: DEPDC1
Gene Name: DEPDC1 DEP domain containing 1 [ Homo sapiens ]
Synonyms: DEPDC1; DEP domain containing 1; DEP.8; SDP35; DEPDC1A; FLJ20354; DEPDC1-V2; DEP domain-containing protein 1A; 5830484J08Rik; cell cycle control protein SDP35
Gene ID: 55635
mRNA Refseq: NM_017779
Protein Refseq: NP_060249
MIM: 612002
UniProt ID: Q5TB30
Chromosome Location: 1p31.2
Function: GTPase activator activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.