"DEPDC1" Related Products

Recombinant Human DEPDC1, GST-tagged

Cat. No. : DEPDC1-120H
Product Overview : Recombinant Human DEPDC1 (93 a.a. - 186 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : DEP domain containing 1 is a protein that in humans is encoded by the DEPDC1 gene.
Source : wheat germ
Molecular Mass : 36.08 kDa
Sequence : GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
Purification : Glutathione Sepharose 4 Fast Flow
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : DEPDC1
Gene Name : DEPDC1 DEP domain containing 1 [ Homo sapiens ]
Synonyms : DEPDC1; DEP domain containing 1; DEP.8; SDP35; DEPDC1A; FLJ20354; DEPDC1-V2; DEP domain-containing protein 1A; 5830484J08Rik; cell cycle control protein SDP35
Gene ID : 55635
mRNA Refseq : NM_017779
Protein Refseq : NP_060249
MIM : 612002
UniProt ID : Q5TB30
Chromosome Location : 1p31.2
Function : GTPase activator activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.