"DEPDC1" Related Products

Recombinant Human DEPDC1, GST-tagged

Cat. No.: DEPDC1-120H
Product Overview: Recombinant Human DEPDC1 (93 a.a. - 186 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: DEP domain containing 1 is a protein that in humans is encoded by the DEPDC1 gene.
Source: wheat germ
Molecular Mass: 36.08 kDa
Sequence: GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
Purification: Glutathione Sepharose 4 Fast Flow
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: DEPDC1
Gene Name: DEPDC1 DEP domain containing 1 [ Homo sapiens ]
Synonyms: DEPDC1; DEP domain containing 1; DEP.8; SDP35; DEPDC1A; FLJ20354; DEPDC1-V2; DEP domain-containing protein 1A; 5830484J08Rik; cell cycle control protein SDP35
Gene ID: 55635
mRNA Refseq: NM_017779
Protein Refseq: NP_060249
MIM: 612002
UniProt ID: Q5TB30
Chromosome Location: 1p31.2
Function: GTPase activator activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.