Recombinant Aeuquorea Victoria EGFP, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Aeuquorea Victoria EGFP, His-tagged

Recombinant Aeuquorea Victoria EGFP, His-tagged

EGFP Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : EGFP-111A
Product Overview : Recombinant Aeuquorea Victoria EGFP, fused with his tag, was expressed in E. coli.
Description : FUNCTION: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. BIOPHYSICOCHEMICAL PROPERTIES: Excitation max (nm): 488; Emission max (nm): 509; Extinction coefficient (Cm-1M-1): 61000. SUBUNIT: Monomer. TISSUE SPECIFICITY: Photocytes. PTM: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), and oxidation of Tyr-(N+1) to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen. BIOTECHNOLOGY: Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. SIMILARITY: Belongs to the GFP family.
Source : E. coli
Species : Aeuquorea Victoria
Tag : His
Form : Lyophilised
Molecular Mass : ~30 kDa
AA Sequence : Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK MVLLEFVTAAGITLGMDELYK
Purity : 92% by SDS-PAGE
Storage : After reconstitution, aliquot and keep at -20°C for long-term storage; for short term keep at 4°C.
Reconstitution : Reconstitute in 100 μl of sterile water. Centrifuge to remove any insoluble material.
Gene Name : EGFP protein
Official Symbol : EGFP
Synonyms : EGFP; Enhanced Green Fluorescent Protein

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.