Recombinant Human CLEC5A protein, His-tagged

• Cat.No.: CLEC5A-11321H
• Product Overview: Recombinant Human CLEC5A protein(32-188 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 32-188 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: NKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CLEC5A C-type lectin domain family 5, member A [ Homo sapiens ]
• Official Symbol: CLEC5A
• Synonyms: CLEC5A; C-type lectin domain family 5, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 5 , CLECSF5; C-type lectin domain family 5 member A; MDL 1; C-type lectin superfamily member 5; myeloid DAP12-associating lectin 1; myeloid DAP12-associating lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; MDL1; MDL-1; CLECSF5; MGC138304
• Gene ID: 23601
• mRNA Refseq: NM_013252
• Protein Refseq: NP_037384
• MIM: 604987
• UniProt ID: Q9NY25