Recombinant Human CLEC5A Protein, GST-tagged
| Cat.No. : | CLEC5A-1472H |
| Product Overview : | Human CLEC5A full-length ORF ( NP_037384.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 47.9 kDa |
| AA Sequence : | MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLEC5A C-type lectin domain family 5, member A [ Homo sapiens ] |
| Official Symbol | CLEC5A |
| Synonyms | CLEC5A; C-type lectin domain family 5, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 5 , CLECSF5; C-type lectin domain family 5 member A; MDL 1; C-type lectin superfamily member 5; myeloid DAP12-associating lectin 1; myeloid DAP12-associating lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; MDL1; MDL-1; CLECSF5; MGC138304; |
| Gene ID | 23601 |
| mRNA Refseq | NM_013252 |
| Protein Refseq | NP_037384 |
| MIM | 604987 |
| UniProt ID | Q9NY25 |
| ◆ Recombinant Proteins | ||
| CLEC5A-86C | Recombinant Cynomolgus CLEC5A, Fc tagged | +Inquiry |
| CLEC5A-1344R | Recombinant Rat CLEC5A protein(Val30-Lys190), His-tagged | +Inquiry |
| Clec5a-21R | Recombinant Rat Clec5a, His tagged | +Inquiry |
| CLEC5A-20H | Recombinant Human CLEC5A Protein, 28-188aa, C-His tagged | +Inquiry |
| CLEC5A-87C | Recombinant Cynomolgus CLEC5A, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC5A-860RCL | Recombinant Rat CLEC5A cell lysate | +Inquiry |
| CLEC5A-815CCL | Recombinant Cynomolgus CLEC5A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC5A Products
Required fields are marked with *
My Review for All CLEC5A Products
Required fields are marked with *
