Recombinant Human CRABP1 protein, His-tagged
Cat.No. : | CRABP1-11550H |
Product Overview : | Recombinant Human CRABP1 protein(1-137 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-137 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANDELILTFGADDVVCTRIYVRE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | CRABP1 |
Synonyms | CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I; |
Gene ID | 1381 |
mRNA Refseq | NM_004378 |
Protein Refseq | NP_004369 |
MIM | 180230 |
UniProt ID | P29762 |
◆ Recombinant Proteins | ||
CRABP1-4996H | Recombinant Human CRABP1 protein, His-tagged | +Inquiry |
CRABP1-1828H | Recombinant Human CRABP1 Protein, GST-tagged | +Inquiry |
CRABP1-3875M | Recombinant Mouse CRABP1 Protein | +Inquiry |
CRABP1-1240R | Recombinant Rat CRABP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRABP1-1800H | Recombinant Human CRABP1 Protein (Met1-Glu137), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRABP1-197HCL | Recombinant Human CRABP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRABP1 Products
Required fields are marked with *
My Review for All CRABP1 Products
Required fields are marked with *