Recombinant Human CRABP1 protein, His-tagged
| Cat.No. : | CRABP1-11550H |
| Product Overview : | Recombinant Human CRABP1 protein(1-137 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | September 17, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-137 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANDELILTFGADDVVCTRIYVRE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | CRABP1 |
| Synonyms | CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I; |
| Gene ID | 1381 |
| mRNA Refseq | NM_004378 |
| Protein Refseq | NP_004369 |
| MIM | 180230 |
| UniProt ID | P29762 |
| ◆ Recombinant Proteins | ||
| CRABP1-1800H | Recombinant Human CRABP1 Protein (Met1-Glu137), N-His tagged | +Inquiry |
| CRABP1-26984TH | Recombinant Human CRABP1 | +Inquiry |
| CRABP1-2253C | Recombinant Chicken CRABP1 | +Inquiry |
| CRABP1-1828H | Recombinant Human CRABP1 Protein, GST-tagged | +Inquiry |
| CRABP1-4996H | Recombinant Human CRABP1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRABP1-197HCL | Recombinant Human CRABP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRABP1 Products
Required fields are marked with *
My Review for All CRABP1 Products
Required fields are marked with *
