Recombinant Human CRABP1 Protein, GST-tagged
Cat.No. : | CRABP1-1828H |
Product Overview : | Human CRABP1 full-length ORF ( AAH22069.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a specific binding protein for a vitamin A family member and is thought to play an important role in retinoic acid-mediated differentiation and proliferation processes. It is structurally similar to the cellular retinol-binding proteins, but binds only retinoic acid at specific sites within the nucleus, which may contribute to vitamin A-directed differentiation in epithelial tissue. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 40.81 kDa |
AA Sequence : | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANNELILTFGADDVVCTRIYVRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRABP1 cellular retinoic acid binding protein 1 [ Homo sapiens ] |
Official Symbol | CRABP1 |
Synonyms | CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I; |
Gene ID | 1381 |
mRNA Refseq | NM_004378 |
Protein Refseq | NP_004369 |
MIM | 180230 |
UniProt ID | P29762 |
◆ Recombinant Proteins | ||
CRABP1-1800H | Recombinant Human CRABP1 Protein (Met1-Glu137), N-His tagged | +Inquiry |
CRABP1-1954M | Recombinant Mouse CRABP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRABP1-2253C | Recombinant Chicken CRABP1 | +Inquiry |
CRABP1-4996H | Recombinant Human CRABP1 protein, His-tagged | +Inquiry |
CRABP1-481H | Recombinant Human cellular retinoic acid binding protein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRABP1-197HCL | Recombinant Human CRABP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRABP1 Products
Required fields are marked with *
My Review for All CRABP1 Products
Required fields are marked with *
0
Inquiry Basket