Recombinant Human CSNK2B protein, His-tagged
| Cat.No. : | CSNK2B-11635H |
| Product Overview : | Recombinant Human CSNK2B protein(NP_001269314)(1-215 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 1-215 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | CSNK2B casein kinase 2 beta [ Homo sapiens (human) ] |
| Official Symbol | CSNK2B |
| Synonyms | G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS |
| Gene ID | 1460 |
| mRNA Refseq | NM_001282385.2 |
| Protein Refseq | NP_001269314.1 |
| MIM | 115441 |
| UniProt ID | P67870 |
| ◆ Recombinant Proteins | ||
| Csnk2b-4755M | Recombinant Mouse Csnk2b protein, Avi-tagged, Biotinylated | +Inquiry |
| CSNK2B-26812TH | Recombinant Human CSNK2B | +Inquiry |
| CSNK2B-11635H | Recombinant Human CSNK2B protein, His-tagged | +Inquiry |
| CSNK2B-5171H | Recombinant Human CSNK2B protein, GST-tagged | +Inquiry |
| CSNK2B-2013H | Recombinant Human CSNK2B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSNK2B-7237HCL | Recombinant Human CSNK2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSNK2B Products
Required fields are marked with *
My Review for All CSNK2B Products
Required fields are marked with *
