Recombinant Human CSNK2B protein, His-tagged

Cat.No. : CSNK2B-11635H
Product Overview : Recombinant Human CSNK2B protein(NP_001269314)(1-215 aa), fused to His tag, was expressed in E. coli.
Availability December 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 1-215 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
Gene Name CSNK2B casein kinase 2 beta [ Homo sapiens (human) ]
Official Symbol CSNK2B
Synonyms G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS
Gene ID 1460
mRNA Refseq NM_001282385.2
Protein Refseq NP_001269314.1
MIM 115441
UniProt ID P67870

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSNK2B Products

Required fields are marked with *

My Review for All CSNK2B Products

Required fields are marked with *

0
cart-icon
0
compare icon