Recombinant Human CSNK2B Protein, GST-tagged

Cat.No. : CSNK2B-2013H
Product Overview : Human CSNK2B full-length ORF ( NP_001311.3, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]
Molecular Mass : 51.3 kDa
AA Sequence : MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Publications :
NLRP3 phosphorylation in its LRR domain critically regulates inflammasome assembly (2021)
Gene Name CSNK2B casein kinase 2, beta polypeptide [ Homo sapiens ]
Official Symbol CSNK2B
Synonyms CSNK2B; casein kinase 2, beta polypeptide; casein kinase II subunit beta; phosvitin; CK II beta; protein G5a; Casein kinase II beta subunit; alternative name: G5a, phosvitin; G5A; CK2B; CK2N; CSK2B; MGC138222; MGC138224;
Gene ID 1460
mRNA Refseq NM_001320
Protein Refseq NP_001311
MIM 115441
UniProt ID P67870

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSNK2B Products

Required fields are marked with *

My Review for All CSNK2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon