Recombinant Human CSNK2B Protein, GST-tagged
Cat.No. : | CSNK2B-2013H |
Product Overview : | Human CSNK2B full-length ORF ( NP_001311.3, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | September 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Publications : |
NLRP3 phosphorylation in its LRR domain critically regulates inflammasome assembly (2021)
|
Gene Name | CSNK2B casein kinase 2, beta polypeptide [ Homo sapiens ] |
Official Symbol | CSNK2B |
Synonyms | CSNK2B; casein kinase 2, beta polypeptide; casein kinase II subunit beta; phosvitin; CK II beta; protein G5a; Casein kinase II beta subunit; alternative name: G5a, phosvitin; G5A; CK2B; CK2N; CSK2B; MGC138222; MGC138224; |
Gene ID | 1460 |
mRNA Refseq | NM_001320 |
Protein Refseq | NP_001311 |
MIM | 115441 |
UniProt ID | P67870 |
◆ Recombinant Proteins | ||
Csnk2b-4756M | Recombinant Mouse Csnk2b protein | +Inquiry |
CSNK2B-731H | Recombinant Human CSNK2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSNK2B-1296R | Recombinant Rat CSNK2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CSNK2B-23H | Recombinant Human casein kinase 2, beta polypeptide | +Inquiry |
CSNK2B-5171H | Recombinant Human CSNK2B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK2B-7237HCL | Recombinant Human CSNK2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSNK2B Products
Required fields are marked with *
My Review for All CSNK2B Products
Required fields are marked with *