Recombinant Human DNAJB13 protein, His-tagged

Cat.No. : DNAJB13-12061H
Product Overview : Recombinant Human DNAJB13 protein(204-316 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability October 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 204-316 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name DNAJB13 DnaJ (Hsp40) homolog, subfamily B, member 13 [ Homo sapiens ]
Official Symbol DNAJB13
Synonyms DNAJB13; DnaJ (Hsp40) homolog, subfamily B, member 13; DnaJ (Hsp40) related, subfamily B, member 13; dnaJ homolog subfamily B member 13; radial spoke 16 homolog A (Chlamydomonas); RSPH16A; TSARG6; 1700014P03Rik; DnaJ-like protein; radial spoke 16 homolog A; testis and spermatogenesis cell-related protein 6; testis spermatogenesis apoptosis-related protein 6; testis spermatocyte apoptosis-related gene 6 protein; testis spermatogenesis apoptosis-related gene 3 protein; testis spermatogenesis apoptosis-related gene 6 protein; TSARG5; FLJ46748;
Gene ID 374407
mRNA Refseq NM_153614
Protein Refseq NP_705842
MIM 610263
UniProt ID P59910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJB13 Products

Required fields are marked with *

My Review for All DNAJB13 Products

Required fields are marked with *

0
cart-icon
0
compare icon