Recombinant Human DNAJB13 Protein, GST-tagged
Cat.No. : | DNAJB13-2734H |
Product Overview : | Human DNAJB13 partial ORF ( NP_705842, 71 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the heat shock protein 40 co-chaperone family which is produced in large amounts in the testis and is located on the radial spokes of the axoneme in human sperm flagella and other flagellar structures. The encoded protein associates with the sperm annulus, as part of the septin complex, through direct interaction with septin 4, during sperm terminal differentiation. Naturally occurring mutations in this gene are associated with primary ciliary dyskinesia and male infertility. [provided by RefSeq, Apr 2017] |
Molecular Mass : | 37.62 kDa |
AA Sequence : | GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJB13 DnaJ (Hsp40) homolog, subfamily B, member 13 [ Homo sapiens ] |
Official Symbol | DNAJB13 |
Synonyms | DNAJB13; DnaJ (Hsp40) homolog, subfamily B, member 13; DnaJ (Hsp40) related, subfamily B, member 13; dnaJ homolog subfamily B member 13; radial spoke 16 homolog A (Chlamydomonas); RSPH16A; TSARG6; 1700014P03Rik; DnaJ-like protein; radial spoke 16 homolog A; testis and spermatogenesis cell-related protein 6; testis spermatogenesis apoptosis-related protein 6; testis spermatocyte apoptosis-related gene 6 protein; testis spermatogenesis apoptosis-related gene 3 protein; testis spermatogenesis apoptosis-related gene 6 protein; TSARG5; FLJ46748; |
Gene ID | 374407 |
mRNA Refseq | NM_153614 |
Protein Refseq | NP_705842 |
MIM | 610263 |
UniProt ID | P59910 |
◆ Recombinant Proteins | ||
DNAJB13-2436M | Recombinant Mouse DNAJB13 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJB13-4686M | Recombinant Mouse DNAJB13 Protein | +Inquiry |
DNAJB13-4034H | Recombinant Human DNAJB13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNAJB13-2378Z | Recombinant Zebrafish DNAJB13 | +Inquiry |
DNAJB13-2392H | Recombinant Human DNAJB13 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJB13 Products
Required fields are marked with *
My Review for All DNAJB13 Products
Required fields are marked with *
0
Inquiry Basket