Recombinant Human DNAJB13 Protein, GST-tagged

Cat.No. : DNAJB13-2734H
Product Overview : Human DNAJB13 partial ORF ( NP_705842, 71 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the heat shock protein 40 co-chaperone family which is produced in large amounts in the testis and is located on the radial spokes of the axoneme in human sperm flagella and other flagellar structures. The encoded protein associates with the sperm annulus, as part of the septin complex, through direct interaction with septin 4, during sperm terminal differentiation. Naturally occurring mutations in this gene are associated with primary ciliary dyskinesia and male infertility. [provided by RefSeq, Apr 2017]
Molecular Mass : 37.62 kDa
AA Sequence : GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJB13 DnaJ (Hsp40) homolog, subfamily B, member 13 [ Homo sapiens ]
Official Symbol DNAJB13
Synonyms DNAJB13; DnaJ (Hsp40) homolog, subfamily B, member 13; DnaJ (Hsp40) related, subfamily B, member 13; dnaJ homolog subfamily B member 13; radial spoke 16 homolog A (Chlamydomonas); RSPH16A; TSARG6; 1700014P03Rik; DnaJ-like protein; radial spoke 16 homolog A; testis and spermatogenesis cell-related protein 6; testis spermatogenesis apoptosis-related protein 6; testis spermatocyte apoptosis-related gene 6 protein; testis spermatogenesis apoptosis-related gene 3 protein; testis spermatogenesis apoptosis-related gene 6 protein; TSARG5; FLJ46748;
Gene ID 374407
mRNA Refseq NM_153614
Protein Refseq NP_705842
MIM 610263
UniProt ID P59910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJB13 Products

Required fields are marked with *

My Review for All DNAJB13 Products

Required fields are marked with *

0
cart-icon