Recombinant Human DNAJB13 protein, His-tagged
| Cat.No. : | DNAJB13-12061H |
| Product Overview : | Recombinant Human DNAJB13 protein(204-316 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 204-316 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DNAJB13 DnaJ (Hsp40) homolog, subfamily B, member 13 [ Homo sapiens ] |
| Official Symbol | DNAJB13 |
| Synonyms | DNAJB13; DnaJ (Hsp40) homolog, subfamily B, member 13; DnaJ (Hsp40) related, subfamily B, member 13; dnaJ homolog subfamily B member 13; radial spoke 16 homolog A (Chlamydomonas); RSPH16A; TSARG6; 1700014P03Rik; DnaJ-like protein; radial spoke 16 homolog A; testis and spermatogenesis cell-related protein 6; testis spermatogenesis apoptosis-related protein 6; testis spermatocyte apoptosis-related gene 6 protein; testis spermatogenesis apoptosis-related gene 3 protein; testis spermatogenesis apoptosis-related gene 6 protein; TSARG5; FLJ46748; |
| Gene ID | 374407 |
| mRNA Refseq | NM_153614 |
| Protein Refseq | NP_705842 |
| MIM | 610263 |
| UniProt ID | P59910 |
| ◆ Recombinant Proteins | ||
| DNAJB13-2436M | Recombinant Mouse DNAJB13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DNAJB13-2734H | Recombinant Human DNAJB13 Protein, GST-tagged | +Inquiry |
| DNAJB13-4686M | Recombinant Mouse DNAJB13 Protein | +Inquiry |
| DNAJB13-2392H | Recombinant Human DNAJB13 Protein, MYC/DDK-tagged | +Inquiry |
| DNAJB13-12061H | Recombinant Human DNAJB13 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJB13 Products
Required fields are marked with *
My Review for All DNAJB13 Products
Required fields are marked with *
