Recombinant Human GRIN3A protein, His-tagged
Cat.No. : | GRIN3A-13536H |
Product Overview : | Recombinant Human GRIN3A protein(976-1081 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 976-1081 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AASequence : | SQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPPRRRELPALRTTNGKADSLNVSRNSVMQELSE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GRIN3A glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [ Homo sapiens ] |
Official Symbol | GRIN3A |
Synonyms | GRIN3A; glutamate receptor, ionotropic, N-methyl-D-aspartate 3A; glutamate [NMDA] receptor subunit 3A; GluN3A; NMDAR3A; N-methyl-D-aspartate receptor subtype 3A; NR3A; NMDAR-L; FLJ45414; |
Gene ID | 116443 |
mRNA Refseq | NM_133445 |
Protein Refseq | NP_597702 |
MIM | 606650 |
UniProt ID | Q8TCU5 |
◆ Recombinant Proteins | ||
GRIN3A-3079H | Recombinant Human GRIN3A Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIN3A-2358R | Recombinant Rat GRIN3A Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIN3A-2704R | Recombinant Rat GRIN3A Protein | +Inquiry |
Grin3a-3309M | Recombinant Mouse Grin3a Protein, Myc/DDK-tagged | +Inquiry |
GRIN3A-805H | Recombinant Human GRIN3A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN3A Products
Required fields are marked with *
My Review for All GRIN3A Products
Required fields are marked with *