Recombinant Human GRIN3A protein, His-tagged
| Cat.No. : | GRIN3A-13536H |
| Product Overview : | Recombinant Human GRIN3A protein(976-1081 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | May 23, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 976-1081 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | SQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPPRRRELPALRTTNGKADSLNVSRNSVMQELSE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GRIN3A glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [ Homo sapiens ] |
| Official Symbol | GRIN3A |
| Synonyms | GRIN3A; glutamate receptor, ionotropic, N-methyl-D-aspartate 3A; glutamate [NMDA] receptor subunit 3A; GluN3A; NMDAR3A; N-methyl-D-aspartate receptor subtype 3A; NR3A; NMDAR-L; FLJ45414; |
| Gene ID | 116443 |
| mRNA Refseq | NM_133445 |
| Protein Refseq | NP_597702 |
| MIM | 606650 |
| UniProt ID | Q8TCU5 |
| ◆ Recombinant Proteins | ||
| GRIN3A-2704R | Recombinant Rat GRIN3A Protein | +Inquiry |
| GRIN3A-2358R | Recombinant Rat GRIN3A Protein, His (Fc)-Avi-tagged | +Inquiry |
| Grin3a-3309M | Recombinant Mouse Grin3a Protein, Myc/DDK-tagged | +Inquiry |
| GRIN3A-2364H | Recombinant Human GRIN3A Protein, MYC/DDK-tagged | +Inquiry |
| GRIN3A-13536H | Recombinant Human GRIN3A protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN3A Products
Required fields are marked with *
My Review for All GRIN3A Products
Required fields are marked with *
