Recombinant Human H2AFJ protein, GST-tagged
Cat.No. : | H2AFJ-13644H |
Product Overview : | Recombinant Human H2AFJ protein(1-129 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-129 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
MIM-Weblink : |
Gene Name | H2AFJ H2A histone family, member J [ Homo sapiens ] |
Official Symbol | H2AFJ |
Synonyms | H2A histone family, member J; 14456; Ensembl:ENSG00000246705; MGC921, FLJ10903, FLJ52230; histone H2A.J;H2a/j; H2AJ |
Gene ID | 55766 |
mRNA Refseq | NM_177925.2 |
Protein Refseq | NP_808760.1 |
UniProt ID | Q9BTM1 |
◆ Recombinant Proteins | ||
H2AFJ-3700H | Recombinant Human H2AFJ Protein (Gly3-Lys129), His tagged | +Inquiry |
H2AFJ-7427M | Recombinant Mouse H2AFJ Protein | +Inquiry |
H2AFJ-4535H | Recombinant Human H2AFJ Protein, GST-tagged | +Inquiry |
H2AFJ-13644H | Recombinant Human H2AFJ protein, GST-tagged | +Inquiry |
H2AFJ-2429R | Recombinant Rat H2AFJ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFJ-5662HCL | Recombinant Human H2AFJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFJ Products
Required fields are marked with *
My Review for All H2AFJ Products
Required fields are marked with *