Recombinant Human HSD11B1 Protein, His-tagged
| Cat.No. : | HSD11B1-13951H |
| Product Overview : | Recombinant Human HSD11B1 Protein (1-292 aa) is produced by E. coli-derived expression system. This protein is fused with a His tag at the N-terminal. |
| Availability | September 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-292 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4,17 mM NaH2PO4, 68 mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| Molecular Mass : | 32 kDa |
| AA Sequence : | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
| Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name | HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ] |
| Official Symbol | HSD11B1 |
| Synonyms | HSD11B1; SDR26C1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539; |
| Gene ID | 3290 |
| mRNA Refseq | NM_001206741 |
| Protein Refseq | NP_001193670 |
| MIM | 600713 |
| ◆ Recombinant Proteins | ||
| HSD11B1-1415H | Recombinant Human HSD11B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HSD11B1-2151R | Recombinant Rhesus monkey HSD11B1 Protein, His-tagged | +Inquiry |
| HSD11B1-22HFL | Active Recombinant Full Length Human HSD11B1 Protein, C-Flag-tagged | +Inquiry |
| Hsd11b1-476R | Recombinant Rat Hsd11b1 Protein, His-tagged | +Inquiry |
| HSD11B1-13951H | Recombinant Human HSD11B1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
| HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *
