Recombinant Full Length Mouse Corticosteroid 11-Beta-Dehydrogenase Isozyme 1(Hsd11B1) Protein, His-Tagged
| Cat.No. : | RFL8000MF |
| Product Overview : | Recombinant Full Length Mouse Corticosteroid 11-beta-dehydrogenase isozyme 1(Hsd11b1) Protein (P50172) (2-292aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-292) |
| Form : | Lyophilized powder |
| AA Sequence : | AVMKNYLLPILVLFLAYYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMFVSN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Hsd11b1 |
| Synonyms | Hsd11b1; Hsd11; Corticosteroid 11-beta-dehydrogenase isozyme 1; 11-beta-hydroxysteroid dehydrogenase 1; 11-DH; 11-beta-HSD1; 11beta-HSD1A |
| UniProt ID | P50172 |
| ◆ Recombinant Proteins | ||
| RFL20235RF | Recombinant Full Length Rat Corticosteroid 11-Beta-Dehydrogenase Isozyme 1(Hsd11B1) Protein, His-Tagged | +Inquiry |
| HSD11B1-2256H | Recombinant Human HSD11B1 Protein, His-tagged | +Inquiry |
| HSD11B1-238HF | Recombinant Full Length Human HSD11B1 Protein | +Inquiry |
| HSD11B1-13951H | Recombinant Human HSD11B1 Protein, His-tagged | +Inquiry |
| HSD11B1-2920R | Recombinant Rat HSD11B1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
| HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hsd11b1 Products
Required fields are marked with *
My Review for All Hsd11b1 Products
Required fields are marked with *
