"AOAH" Related Products

Expand
Expand

Recombinant Human AOAH, GST-tagged

Cat.No.: AOAH-150H
Product Overview: Human AOAH full-length ORF ( NP_001628.1, 1 a.a. - 575 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This locus encodes both the light and heavy subunits of acyloxyacyl hydrolase. The encoded enzyme catalyzes the hydrolysis of acyloxylacyl-linked fatty acyl chains from bacterial lipopolysaccharides, effectively detoxifying these molecules. The encoded protein may play a role in modulating host inflammatory response to gram-negative bacteria. Alternatively spliced transcript variants have been described.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 91.5 kDa
Protein length: 1 a.a. - 575 a.a.
AA Sequence: MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLCSYLPE KLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKARQIVKKSPIL KYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVH QDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQ LSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVLDYPAIVIYAMIGNDV CSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPDGTFLWDNLHNRYHPLGQLNKDMTYAQLYSF LNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEP VDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: AOAH acyloxyacyl hydrolase (neutrophil) [ Homo sapiens (human) ]
Official Symbol: AOAH
Synonyms: AOAH; acyloxyacyl hydrolase (neutrophil); acyloxyacyl hydrolase; EC 3.1.1.77
Gene ID: 313
mRNA Refseq: NM_001637
Protein Refseq: NP_001628
MIM: 102593
UniProt ID: P28039
Chromosome Location: 7p14-p12
Function: acyloxyacyl hydrolase activity; catalytic activity; lipoprotein lipase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.