Recombinant Human HPGD, His-tagged HPGD-15H

Recombinant Human HPGD, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human HPGD, His-tagged

Recombinant Human HPGD, His-tagged

HPGD Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HPGD-15H
Product Overview : Recombinant Human 15-Hydroxyprostaglandin Dehydrogenase [NAD(+)]/HPGD is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln266) of Human HPGD fused with a polyhistidine tag at the C-terminus.
Source : HEK293
Species : Human
Tag : His
AA Sequence : MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLF IQCD VADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD YMSKQNGG EGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA ICPGFVNTAILE SIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG AIMKITTSKGIHFQDY DTTPFQAKTQVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name : HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ]
Official Symbol : HPGD
Synonyms : HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1; PGDH; PGDH1; PHOAR1; 15-PGDH;
Gene ID : 3248
mRNA Refseq : NM_000860
Protein Refseq : NP_000851
MIM : 601688
UniProt ID : P15428
Chromosome Location : 4q34-q35
Pathway : Prostaglandin Synthesis and Regulation, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;
Function : 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; NAD binding; NAD+ binding; catalytic activity; nucleotide binding; oxidoreductase activity; prostaglandin E receptor activity; protein homodimerization activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy