"ACSS3" Related Products

Expand

Recombinant Human ACSS3, His-tagged

Cat.No.: ACSS3-18H
Product Overview: Recombinant Human Acyl-CoA Synthetase Short-Chain Family Member 3 Mitochondrial/ACSS3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala30-Ala686) of Human ACSS3 fused with a polyhistidine tag at the C-terminus.
Description: Acyl-CoA Synthetase Short-Chain Family Member 3 Mitochondrial (ACSS3) is a member of the ATP-dependent AMP-binding enzyme family. ACSS3 localizes to the mitochondrion and catalyzes acetate and CoA into diphosphate and acetyl-CoA using the ATP. ACSS3 activates acetate for lipid synthesis use or for energy generation. Two isoforms of the human protein are produced by alternative splicing.
Source: HEK293
Species: Human
Tag: His
AA Sequence: AGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTL ENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGV LVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASF GIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVL SEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYG PLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFK TLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNV MILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYL YVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQ VLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHV EEMLKQAVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: ACSS3 acyl-CoA synthetase short-chain family member 3 [ Homo sapiens ]
Official Symbol: ACSS3
Synonyms: ACSS3; acyl-CoA synthetase short-chain family member 3; acyl-CoA synthetase short-chain family member 3, mitochondrial; FLJ21963; AMP-binding enzyme, 33217;
Gene ID: 79611
mRNA Refseq: NM_024560
Protein Refseq: NP_078836
MIM: 614356
UniProt ID: Q9H6R3
Chromosome Location: 12q21.31
Pathway: Metabolic pathways, organism-specific biosystem; Propanoate metabolism, organism-specific biosystem; Propanoate metabolism, conserved biosystem; acetate conversion to acetyl-CoA, organism-specific biosystem; ethanol degradation II, organism-specific biosystem; ethanol degradation IV, organism-specific biosystem; oxidative ethanol degradation III, organism-specific biosystem;
Function: ATP binding; acetate-CoA ligase activity; ligase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.