"ACTR8" Related Products

Recombinant Human ACTR8, His-tagged

Cat.No.: ACTR8-19H
Product Overview: Recombinant Human Actin-Related Protein 8/ACTR8 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Trp329) of Human ACTR8 fused with a His tag at the N-terminus.
Description: Actin-Related Protein 8 (ACTR8) is a member of the Actin family. ACTR8 is the first example in actin family that was found to be associated with mitotic chromosomes. ACTR8 plays a vital role in the functional organization of mitotic chromosomes. This protein is a proposed core component of the chromatin remodeling INO80 complex that is involved in transcriptional regulation, DNA replication and probable DNA repair, and it is required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage.
Source: E. coli
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of PBS, 1mM DTT, pH 7.4
AA Sequence: MNHKVHHHHHHMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTR IFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQG DPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGD GLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMF HKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQ RFGVRMLRERAAFVW
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at Please minimize freeze-thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.