Recombinant Human ACTR8, His-tagged

Cat.No. : ACTR8-19H
Product Overview : Recombinant Human Actin-Related Protein 8/ACTR8 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Trp329) of Human ACTR8 fused with a His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-329 a.a.
Description : Actin-Related Protein 8 (ACTR8) is a member of the Actin family. ACTR8 is the first example in actin family that was found to be associated with mitotic chromosomes. ACTR8 plays a vital role in the functional organization of mitotic chromosomes. This protein is a proposed core component of the chromatin remodeling INO80 complex that is involved in transcriptional regulation, DNA replication and probable DNA repair, and it is required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage.
Form : Supplied as a 0.2 μM filtered solution of PBS, 1mM DTT, pH 7.4
AA Sequence : MNHKVHHHHHHMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTR IFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQG DPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGD GLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMF HKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQ RFGVRMLRERAAFVW
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTR8 Products

Required fields are marked with *

My Review for All ACTR8 Products

Required fields are marked with *

0
cart-icon