"ART5" Related Products

Expand

Recombinant Human ART5, His-tagged

Cat.No.: ART5-33H
Product Overview: Recombinant Human Ecto-ADP-Ribosyltransferase 5/ART5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro291) of Human ART5 fused with a polyhistidine tag at the C-terminus.
Description: Ecto-ADP-Ribosyltransferase 5 (ART5) is a member of the ARG-specific ADP-ribosyltransferase family. Members of this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. ART5 is a secreted protein and contains four NAD binding sites. ART5 proposes to regulate the endocytosis of plasma membrane proteins by recruiting the ubiquitin ligase Rsp5p to its target in the plasma membrane.
Source: HEK293
Species: Human
Tag: His
AA Sequence: VPTILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETWEDKRRGLTLPP GFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGGCS RGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVF PKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDL HMTKRHLQQP
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: ART5 ADP-ribosyltransferase 5 [ Homo sapiens ]
Official Symbol: ART5
Synonyms: ART5; ADP-ribosyltransferase 5; ecto-ADP-ribosyltransferase 5; mono(ADP-ribosyl)transferase 5; NAD(P)(+)--arginine ADP-ribosyltransferase 5; MGC22848;
Gene ID: 116969
mRNA Refseq: NM_001079536
Protein Refseq: NP_001073004
MIM: 610625
UniProt ID: Q96L15
Chromosome Location: 11p15.4
Function: NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ nucleosidase activity; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.