Recombinant Human B4GALT5, His-tagged
Cat.No. : | B4GALT5-42H |
Product Overview : | Recombinant Human β-1,4-Galactosyltransferase 5/B4GALT5 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Pro36-Tyr388) of Human B4GALT5 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 36-388 a.a. |
Description : | β-1,4-Galactosyltransferase 5 (B4GALT5) is a single-pass type II membrane protein that belongs to the glycosyltransferase 7 family. B4GALT5 includes a cytoplasmic domain (aa 1-14), a transmembrane segment (aa 15-35), and an extracellular region (aa36 - 388). B4GALT5 is ubiquitously expressed in many tissues and required for Manganese as cofactor. The B4GALT5 function is responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM HEPES, 150mM NaCl, 10% Glycerol, pH 7.5 |
AA Sequence : | PGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTT FLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVA ILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCL IFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWG WGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN YFANITYDALYKNITVNLTPELAQVNEYVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | B4GALT5 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 [ Homo sapiens ] |
Official Symbol | B4GALT5 |
Synonyms | B4GALT5; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5; beta-1,4-galactosyltransferase 5; beta4 GalT IV; beta4GalT V; beta4-GalT IV; beta-1,4-GalT II; beta-1,4-GalT IV; beta-1,4-GalTase 5; beta-1.4-galactosyltransferase V; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5; gt-V; B4Gal-T5; beta4Gal-T5; beta4GalT-V; BETA4-GALT-IV; MGC138470; |
Gene ID | 9334 |
mRNA Refseq | NM_004776 |
Protein Refseq | NP_004767 |
MIM | 604016 |
UniProt ID | O43286 |
Chromosome Location | 20q13.1-q13.2 |
Pathway | Asparagine N-linked glycosylation, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; N-Glycan antennae elongation, organism-specific biosystem; N-glycan antennae elongation in the medial/trans-Golgi, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; |
Function | galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
B4GALT5-1744HF | Recombinant Full Length Human B4GALT5 Protein | +Inquiry |
B4GALT5-42H | Recombinant Human B4GALT5, His-tagged | +Inquiry |
B4GALT5-033H | Recombinant Human B4GALT5 protein | +Inquiry |
B4GALT5-034H | Recombinant Human B4GALT5 protein, GST-tagged | +Inquiry |
B4GALT5-10114H | Recombinant Human B4GALT5, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B4GALT5 Products
Required fields are marked with *
My Review for All B4GALT5 Products
Required fields are marked with *