Recombinant Human CA11, His-tagged

Cat.No. : CA11-50H
Product Overview : Recombinant Human Carbonic Anhydrase-Related Protein 11/CA11 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His34-Arg328) of Human CA11 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 34-328 a.a.
Description : Carbonic Anhydrase-Related Protein 11 (CA11) is a secreted protein member of the α-carbonic anhydrase family. Carbonic Anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA11 is expressed abundantly in the brain with moderate expression also present in spinal cord and thyroid. CA11 may play a general role in the central nervous system.
AA Sequence : HIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLR LSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQG FSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYF LQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQS LSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGRVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name CA11 carbonic anhydrase XI [ Homo sapiens ]
Official Symbol CA11
Synonyms CA11; carbonic anhydrase XI; carbonic anhydrase-related protein 11; CA RP XI; carbonic anhydrase related protein 2; carbonic anhydrase related protein XI; CARP2; CARPX1; CA-XI; CARP-2; CARP XI; CA-RP II; carbonic anhydrase-related protein 2; carbonic anhydrase-related protein XI;
Gene ID 770
mRNA Refseq NM_001217
Protein Refseq NP_001208
MIM 604644
UniProt ID O75493
Chromosome Location 19q13.3
Function NOT carbonate dehydratase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA11 Products

Required fields are marked with *

My Review for All CA11 Products

Required fields are marked with *

0
cart-icon