Recombinant Human CA11, His-tagged
Cat.No. : | CA11-50H |
Product Overview : | Recombinant Human Carbonic Anhydrase-Related Protein 11/CA11 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His34-Arg328) of Human CA11 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 34-328 a.a. |
Description : | Carbonic Anhydrase-Related Protein 11 (CA11) is a secreted protein member of the α-carbonic anhydrase family. Carbonic Anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA11 is expressed abundantly in the brain with moderate expression also present in spinal cord and thyroid. CA11 may play a general role in the central nervous system. |
AA Sequence : | HIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLR LSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQG FSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYF LQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQS LSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGRVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | CA11 carbonic anhydrase XI [ Homo sapiens ] |
Official Symbol | CA11 |
Synonyms | CA11; carbonic anhydrase XI; carbonic anhydrase-related protein 11; CA RP XI; carbonic anhydrase related protein 2; carbonic anhydrase related protein XI; CARP2; CARPX1; CA-XI; CARP-2; CARP XI; CA-RP II; carbonic anhydrase-related protein 2; carbonic anhydrase-related protein XI; |
Gene ID | 770 |
mRNA Refseq | NM_001217 |
Protein Refseq | NP_001208 |
MIM | 604644 |
UniProt ID | O75493 |
Chromosome Location | 19q13.3 |
Function | NOT carbonate dehydratase activity; |
◆ Recombinant Proteins | ||
CA11-0354H | Recombinant Human CA11 Protein (His24-Arg328), C-His-tagged | +Inquiry |
CA11-0231H | Recombinant Human CA11 Protein, GST-Tagged | +Inquiry |
CA11-50H | Recombinant Human CA11, His-tagged | +Inquiry |
CA11-1153M | Recombinant Mouse CA11 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAR11-2713M | Recombinant Mouse CAR11 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA11-7916HCL | Recombinant Human CA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA11 Products
Required fields are marked with *
My Review for All CA11 Products
Required fields are marked with *
0
Inquiry Basket