"SH3KBP1" Related Products

Recombinant Human SH3KBP1, His-tagged

Cat.No.: SH3KBP1-57H
Product Overview: Recombinant Human SH3 Domain-Containing Kinase-Binding Protein 1/SH3KBP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Lys665) of Human SH3KBP1 fused with a 6His tag at the C-terminus.
Description: SH3 Domain-Containing Kinase-Binding Protein 1 (SH3KBP1) contains 3 SH3 domains. SH3KBP1 is widely expressed in many tissues, it is also expressed in some cancer cell lines. SH3KBP1 plays a role in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases. SH3KBP1 is involved in regulation of ligand-dependent endocytosis of the IgE receptor and in the regulation of cellular stress response via the MAPK pathways. SH3KBP1 is also required for the control of cell shape and migration.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPL TNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGE VEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEG ANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKT EMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKL LPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDL QKPSVPAIPPKKPRPPKTNSLSRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLS DRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHI SLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGGGGPAPLSSAVPSPLSSSLGTAGHRA NSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLR LQMEVNDIKKALQSKVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: SH3KBP1 reserved [ Homo sapiens ]
Official Symbol: SH3KBP1
Synonyms: SH3KBP1; reserved;
Gene ID: 94010

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.