Recombinant Human CD99L2, His-tagged CD99L2-61H

Recombinant Human CD99L2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD99L2, His-tagged

Recombinant Human CD99L2, His-tagged

CD99L2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD99L2-61H
Product Overview : Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp26-Ala188) of Human CD99L2 fused with a polyhistidine tag at the C-terminus.
Description : CD99 Antigen-Like Protein 2 (CD99L2) belongs to the CD99 family. CD99L2 is a single-pass type I membrane protein and expressed in many tissues, with low expression in thymus. CD99L2 plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.
Source : HEK293
Species : Human
Tag : His
AA Sequence : DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIG GRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVG GGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name : CD99L2 CD99 molecule-like 2 [ Homo sapiens ]
Official Symbol : CD99L2
Synonyms : CD99L2; CD99 molecule-like 2; CD99 antigen like 2 , MIC2 like 1 , MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024;
Gene ID : 83692
mRNA Refseq : NM_001184808
Protein Refseq : NP_001171737
MIM : 300846
UniProt ID : Q8TCZ2
Chromosome Location : Xq28

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy