"CELA3A" Related Products

Expand

Recombinant Human CELA3A, His-tagged

Cat.No.: CELA3A-64H
Product Overview: Recombinant Human Chymotrypsin-Like Elastase Family Member 3A/CELA3A is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser16-His270) of Human CELA3A fused with a 6His tag at the C-terminus.
Description: Chymotrypsin-Like Elastase Family Member 3A (CELA3A) is an enzyme that contains one peptidase S1 domain. ELA3A belongs to the peptidase S1 family of the Elastase subfamily. ELA3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. ELA3A may also function in the intestinal transport and metabolism of cholesterol. ELA3A is efficient protease with alanine specificity but only little elastolytic activity. ELA3A preferentially cleaves proteins after alanine residues.
Source: HEK293
Species: Human
Tag: His
AA Sequence: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLT YQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLP PAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIR SGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASHVDHHH HHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: CELA3A chymotrypsin-like elastase family, member 3A [ Homo sapiens ]
Official Symbol: CELA3A
Synonyms: CELA3A; chymotrypsin-like elastase family, member 3A; ELA3A, elastase 3A, pancreatic , elastase 3A, pancreatic (protease E); chymotrypsin-like elastase family member 3A; ELA3; protease E; elastase 1; elastase-3A; elastase IIIA; elastase 3A, pancreatic; ELA3A;
Gene ID: 10136
mRNA Refseq: NM_005747
Protein Refseq: NP_005738
UniProt ID: P09093
Chromosome Location: 1p36.12
Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function: peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.