Recombinant Human CELA3A, His-tagged
Cat.No. : | CELA3A-64H |
Product Overview : | Recombinant Human Chymotrypsin-Like Elastase Family Member 3A/CELA3A is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser16-His270) of Human CELA3A fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 16-270 a.a. |
Description : | Chymotrypsin-Like Elastase Family Member 3A (CELA3A) is an enzyme that contains one peptidase S1 domain. ELA3A belongs to the peptidase S1 family of the Elastase subfamily. ELA3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. ELA3A may also function in the intestinal transport and metabolism of cholesterol. ELA3A is efficient protease with alanine specificity but only little elastolytic activity. ELA3A preferentially cleaves proteins after alanine residues. |
AA Sequence : | SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLT YQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLP PAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIR SGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASHVDHHH HHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | CELA3A chymotrypsin-like elastase family, member 3A [ Homo sapiens ] |
Official Symbol | CELA3A |
Synonyms | CELA3A; chymotrypsin-like elastase family, member 3A; ELA3A, elastase 3A, pancreatic , elastase 3A, pancreatic (protease E); chymotrypsin-like elastase family member 3A; ELA3; protease E; elastase 1; elastase-3A; elastase IIIA; elastase 3A, pancreatic; ELA3A; |
Gene ID | 10136 |
mRNA Refseq | NM_005747 |
Protein Refseq | NP_005738 |
UniProt ID | P09093 |
Chromosome Location | 1p36.12 |
Pathway | Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
Function | peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
CELA3A-0984H | Recombinant Human CELA3A Protein (Ser16-His270), N-GST tagged | +Inquiry |
CELA3A-3224H | Recombinant Human CELA3A Protein, GST-tagged | +Inquiry |
CELA3A-29H | Recombinant Human CELA3A Protein (inactive variant S217A, AA 16-270), C-His-Tagged | +Inquiry |
CELA3A-1162H | Recombinant Human CELA3A protein, His & GST-tagged | +Inquiry |
CELA3A-27H | Recombinant Human CELA3A Protein (AA 18-270), C-GFP/His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3A-7592HCL | Recombinant Human CELA3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELA3A Products
Required fields are marked with *
My Review for All CELA3A Products
Required fields are marked with *