Recombinant Human CELA3A, His-tagged

Cat.No. : CELA3A-64H
Product Overview : Recombinant Human Chymotrypsin-Like Elastase Family Member 3A/CELA3A is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser16-His270) of Human CELA3A fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 16-270 a.a.
Description : Chymotrypsin-Like Elastase Family Member 3A (CELA3A) is an enzyme that contains one peptidase S1 domain. ELA3A belongs to the peptidase S1 family of the Elastase subfamily. ELA3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. ELA3A may also function in the intestinal transport and metabolism of cholesterol. ELA3A is efficient protease with alanine specificity but only little elastolytic activity. ELA3A preferentially cleaves proteins after alanine residues.
AA Sequence : SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLT YQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLP PAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIR SGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASHVDHHH HHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name CELA3A chymotrypsin-like elastase family, member 3A [ Homo sapiens ]
Official Symbol CELA3A
Synonyms CELA3A; chymotrypsin-like elastase family, member 3A; ELA3A, elastase 3A, pancreatic , elastase 3A, pancreatic (protease E); chymotrypsin-like elastase family member 3A; ELA3; protease E; elastase 1; elastase-3A; elastase IIIA; elastase 3A, pancreatic; ELA3A;
Gene ID 10136
mRNA Refseq NM_005747
Protein Refseq NP_005738
UniProt ID P09093
Chromosome Location 1p36.12
Pathway Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELA3A Products

Required fields are marked with *

My Review for All CELA3A Products

Required fields are marked with *

0
cart-icon