Recombinant Full Length Human CELA3A Protein, GST-tagged
Cat.No. : | CELA3A-4328HF |
Product Overview : | Human ELA3A full-length ORF ( AAH07028, 16 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 16-270 amino acids |
Description : | Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 53.79 kDa |
AA Sequence : | SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CELA3A chymotrypsin like elastase family member 3A [ Homo sapiens (human) ] |
Official Symbol | CELA3A |
Synonyms | CELA3A; chymotrypsin like elastase family member 3A; Chymotrypsin Like Elastase Family Member 3A; Protease E; Elastase 3A, Pancreatic; Elastase IIIA; Elastase-3A; ELA3A; ELA3; Chymotrypsin-Like Elastase Family, Member 3A; Chymotrypsin-Like Elastase Family Member 3A; Elastase 3A, Pancreatic (Protease E); EC 3.4.21.70; Elastase 1; EC 3.4.21; chymotrypsin-like elastase family member 3A; elastase 1; elastase 3A, pancreatic; elastase IIIA; elastase-3A; protease E |
Gene ID | 10136 |
mRNA Refseq | NM_005747 |
Protein Refseq | NP_005738 |
MIM | 618693 |
UniProt ID | P09093 |
◆ Recombinant Proteins | ||
CELA3A-2845H | Recombinant Human CELA3A protein, His-SUMO-tagged | +Inquiry |
CELA3A-27H | Recombinant Human CELA3A Protein (AA 18-270), C-GFP/His-Tagged | +Inquiry |
CELA3A-3224H | Recombinant Human CELA3A Protein, GST-tagged | +Inquiry |
CELA3A-64H | Recombinant Human CELA3A, His-tagged | +Inquiry |
CELA3A-1162H | Recombinant Human CELA3A protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3A-7592HCL | Recombinant Human CELA3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CELA3A Products
Required fields are marked with *
My Review for All CELA3A Products
Required fields are marked with *
0
Inquiry Basket