Recombinant Human CELA3A protein, His-SUMO-tagged
Cat.No. : | CELA3A-2845H |
Product Overview : | Recombinant Human CELA3A protein(P09093)(29-270aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 29-270aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CELA3A chymotrypsin-like elastase family, member 3A [ Homo sapiens ] |
Official Symbol | CELA3A |
Synonyms | CELA3A; chymotrypsin-like elastase family, member 3A; ELA3A, elastase 3A, pancreatic , elastase 3A, pancreatic (protease E); chymotrypsin-like elastase family member 3A; ELA3; protease E; elastase 1; elastase-3A; elastase IIIA; elastase 3A, pancreatic; ELA3A; |
Gene ID | 10136 |
mRNA Refseq | NM_005747 |
Protein Refseq | NP_005738 |
UniProt ID | P09093 |
◆ Recombinant Proteins | ||
CELA3A-4328HF | Recombinant Full Length Human CELA3A Protein, GST-tagged | +Inquiry |
CELA3A-27H | Recombinant Human CELA3A Protein (AA 18-270), C-GFP/His-Tagged | +Inquiry |
CELA3A-1162H | Recombinant Human CELA3A protein, His & GST-tagged | +Inquiry |
CELA3A-3224H | Recombinant Human CELA3A Protein, GST-tagged | +Inquiry |
CELA3A-28H | Recombinant Human CELA3A Protein (AA 18-270), C-His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3A-7592HCL | Recombinant Human CELA3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CELA3A Products
Required fields are marked with *
My Review for All CELA3A Products
Required fields are marked with *
0
Inquiry Basket