Recombinant Human CELA3A protein, His-SUMO-tagged
| Cat.No. : | CELA3A-2845H |
| Product Overview : | Recombinant Human CELA3A protein(P09093)(29-270aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 29-270aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.6 kDa |
| AA Sequence : | VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CELA3A chymotrypsin-like elastase family, member 3A [ Homo sapiens ] |
| Official Symbol | CELA3A |
| Synonyms | CELA3A; chymotrypsin-like elastase family, member 3A; ELA3A, elastase 3A, pancreatic , elastase 3A, pancreatic (protease E); chymotrypsin-like elastase family member 3A; ELA3; protease E; elastase 1; elastase-3A; elastase IIIA; elastase 3A, pancreatic; ELA3A; |
| Gene ID | 10136 |
| mRNA Refseq | NM_005747 |
| Protein Refseq | NP_005738 |
| UniProt ID | P09093 |
| ◆ Recombinant Proteins | ||
| CELA3A-2845H | Recombinant Human CELA3A protein, His-SUMO-tagged | +Inquiry |
| CELA3A-28H | Recombinant Human CELA3A Protein (AA 18-270), C-His-Tagged | +Inquiry |
| CELA3A-0984H | Recombinant Human CELA3A Protein (Ser16-His270), N-GST tagged | +Inquiry |
| CELA3A-27H | Recombinant Human CELA3A Protein (AA 18-270), C-GFP/His-Tagged | +Inquiry |
| CELA3A-3224H | Recombinant Human CELA3A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CELA3A-7592HCL | Recombinant Human CELA3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELA3A Products
Required fields are marked with *
My Review for All CELA3A Products
Required fields are marked with *
